KEGG   Paenibacillus sp. JDR-2: Pjdr2_5020Help
Entry
Pjdr2_5020        CDS       T00977                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABM DUF4188 DUF3291 Dabb
Motif
Other DBs
NCBI-ProteinID: ACT03631
UniProt: C6D0N2
Position
5746170..5746493
Genome map
AA seq 107 aa AA seqDB search
MVKGTCYAVIFSSQRTDGDHGYGAMADKMEELAQEQPGFISVESVRDASGAGITISYWES
LEAIHNWRQNGLHQVAQEKGKQAWYQSYNVKICKVERAYSYPAADHS
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagggaacttgttatgcggttattttttcgagtcaacggacggacggggatcat
gggtacggcgcgatggccgacaaaatggaggagcttgcccaggagcagcctggattcata
tccgtggagagcgtaagggatgcctcgggagcaggtattacgatttcctattgggaaagc
ctggaggcgattcataactggaggcagaacgggctgcaccaggttgctcaggagaaaggc
aaacaagcctggtatcagagctacaacgtaaaaatctgtaaagtggaacgtgcctattcc
tacccggcagccgatcattcatga

DBGET integrated database retrieval system