KEGG   Paenibacillus sp. JDR-2: Pjdr2_5023Help
Entry
Pjdr2_5023        CDS       T00977                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT03634
UniProt: C6D0N5
Position
complement(5747555..5748121)
Genome map
AA seq 188 aa AA seqDB search
MIFDHITHYYNSVPFRSLSALSWEEALKVMEEMCDDTPFFERFKEPVQYWENRIETENWL
RKSFIQKGGKPKDKIPIYSVLGTAVWIEDYSSANGLAVEKIRIPLSAFEESDISFTFPDS
MVSFWIARDKPEAYYHPDYHGHVFTLTEIKSLMTSELMNKIEFMHPEGTIPYVEAQIWNK
DLVKNYKT
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatattcgatcatataacccactattacaattccgtgccttttagaagcttatctgcg
ctatcatgggaggaagctttaaaagtcatggaggaaatgtgcgatgatactccgtttttc
gaaagattcaaggaacccgttcagtattgggaaaaccggatagaaactgaaaactggttg
aggaaaagctttatccaaaagggcggaaaaccaaaggataaaattcctatttactctgtg
cttggcacggcagtctggatagaggattattcatcagccaatggtttagccgtcgagaag
attcgaattcctctatccgcattcgaagaaagtgatatcagctttacttttccggacagc
atggtttctttttggatagcaagagacaaaccggaagcttactatcatcccgattatcat
gggcatgtctttacgttaacggaaataaagagtctgatgacaagcgagttaatgaataaa
atcgaattcatgcaccccgagggtacaataccctatgtcgaggcgcaaatttggaataag
gatcttgtgaaaaattacaaaacgtaa

DBGET integrated database retrieval system