KEGG   Paenibacillus sp. JDR-2: Pjdr2_5026Help
Entry
Pjdr2_5026        CDS       T00977                                 

Definition
(GenBank) hypothetical protein
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DIM
Motif
Other DBs
NCBI-ProteinID: ACT03637
UniProt: C6D0N8
Position
complement(5750872..5751024)
Genome map
AA seq 50 aa AA seqDB search
MGIFLIIAFVIMLLAVLNIDGKIKKHLENQKLIIKKLDLLLHAQTNKDSE
NT seq 153 nt NT seq  +upstreamnt  +downstreamnt
atggggattttccttatcattgcgtttgtcattatgctgctggccgtgctcaatatagac
gggaaaataaagaagcatttggagaatcagaagcttataatcaagaagcttgatcttctg
ctccatgctcaaaccaataaagactccgaataa

DBGET integrated database retrieval system