KEGG   Paenibacillus sp. JDR-2: Pjdr2_5027Help
Entry
Pjdr2_5027        CDS       T00977                                 

Definition
(GenBank) Aldose 1-epimerase
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DUF4432
Motif
Other DBs
NCBI-ProteinID: ACT03638
UniProt: C6D0N9
Position
complement(5751417..5752415)
Genome map
AA seq 332 aa AA seqDB search
MTVNQANEGLFHGERAIWLRFGPYEAALLPEIGGNLIAFRDVEKEYRFLHEPTPEEMESF
KARPMIHGIPVLFPPNRYEDGKFPWEGKVHQFDVNEPATGNHLHGFLYQTPWQVEDFGTT
KTESYVVVSVQVDENHPSYASFPFNYTIRLRYSLSENGLLQQVTVRNDGEEVMPCLLAFH
TSVNAPFVPGGQAQDYRIHMTLGERWELNERMLPTGQYQPLKEEEQLMRDSGVYPFFEAM
DNHYTARPQNGRNLMELTDTKAGIKLVYDVGTSYKQWMIWNNNATEGFFCPEPQINLVNA
PNVDLPADEIGLLSLAAGEIFEESSRLYVIKG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacggtaaatcaagcaaacgaaggattatttcacggcgaacgcgcgatttggctgcga
tttggaccgtacgaggctgctcttcttcctgagatcggcggcaacctgattgcttttcgc
gatgtagaaaaggaataccgtttcctgcatgaaccaacgcccgaggagatggagagcttc
aaggcaagaccgatgatccacggcattcccgtactgttcccgccgaaccgctatgaggac
ggcaaattcccttgggaggggaaagttcatcaatttgatgtaaacgaaccggcaacgggc
aaccatctgcatggtttcctctatcaaacgccgtggcaagtagaagacttcggcacaaca
aagacggaaagctatgtggttgtatcggttcaggtggatgagaaccatccttcctatgcc
agcttcccgttcaactatacgatccgcctccgttactcgttaagcgagaatggtctgctg
cagcaggtgacggtccgcaatgacggagaagaggtaatgccttgcctgctcgctttccat
acctcggtgaacgcaccgtttgtgccgggcggacaagctcaggattaccgcatccatatg
acgcttggcgagcgttgggagctgaatgagcggatgctgccaacggggcagtatcagcct
ctgaaggaagaagagcagcttatgcgcgacagcggcgtatatccgttcttcgaagcgatg
gataaccactatacggctcgtcctcagaacggacgcaacctgatggagcttaccgatacg
aaggctggcattaagcttgtctatgatgtaggcacctcctacaagcagtggatgatctgg
aataacaatgcgacggagggtttcttctgcccagagccgcagattaatctggtgaacgcg
cctaatgtggatctgcctgccgatgaaatcgggctccttagcctggctgcgggagagatt
ttcgaggaatccagccggctgtatgttataaaaggctaa

DBGET integrated database retrieval system