KEGG   Paenibacillus sp. JDR-2: Pjdr2_5028Help
Entry
Pjdr2_5028        CDS       T00977                                 

Definition
(GenBank) protein of unknown function DUF1680
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_127
Motif
Other DBs
NCBI-ProteinID: ACT03639
UniProt: C6D0P0
Position
complement(5752447..5754324)
Genome map
AA seq 625 aa AA seqDB search
MKSIFEALPLGSIQAEGWLYNQLRIQADGLTGHLEEHWADVGPDNGWIGGNGESWERGPY
YLDGLLPLAYILNDETLIAKANRWVEWALNSQQESGMFGPARIETVNNDVSKEQDWWHYM
IMLKVFTQYEEATGDARVIPFLTKFADYVAGKIEDQPLQGWAKARGAELLLCLIWLYKRT
GKEELLKLASIVKEQTTDWTDIFYDFPFWRKVEQWDWRTHVVNVAMGLKTPGVLYELTED
SHELEAVYRGIESLMTYHGQAHGMFSGDEWLSGTHPSQGVELCAVVEYMFTLEQLTRIFG
DGKFADVLEKVAFNALPAAISADWTSHQYDQQVNQIICNVAPRAWSNGPYANVFGLEPNF
GCCTANMHQGWPKLVSHLWMKDNGGGLAAVSYAPCLIRTDVAGGVKAELRVSGEYPFRER
VKVELQLEHPASFAVRLRIPGWCEAPVITVNGTAASLEIKQGYAAINREWQTGDRIELTL
PMEPKTVSRNLYAVSVERGPLVYALPVEESWQLLRKRERFHDYELYPASPWKYGLLADST
FKAVTSSEEIPYQPFLAVESPVKLAVLGQLVPDWRMEGNNAGTPPIAPNTDDQPVTELML
VPYGGAKLRIGEFPLIGERKTSRTR
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtatctttgaggctctgccgcttggcagcattcaagcggaggggtggctgtac
aaccagcttcggattcaagcagacggattaacgggacatctggaggagcattgggcggac
gttggcccggataacggatggattggcggcaacggcgaaagctgggagcgtggtccttat
tatttggacggattgctgccgctagcttatattttgaacgatgagacattgattgcgaag
gcaaaccgctgggtggagtgggcgctgaacagccagcaggagagcggcatgtttgggccg
gcacgaatcgagacggtgaataatgacgtgagcaaggagcaggattggtggcattacatg
atcatgctcaaggtctttacgcaatatgaggaagcgaccggcgatgcgcgggttattccg
ttcctgacgaaattcgcggattacgtggccgggaagattgaggaccagccgctgcaggga
tgggctaaagcgcgcggtgcggagctgctgctctgcctcatctggctgtataagcgcacc
gggaaagaagagctgctgaagctggcttccatcgtgaaggagcagacaacggactggacc
gatatcttttatgattttccgttctggcggaaggttgagcagtgggattggagaacgcat
gtcgttaatgtggcgatgggactcaagacgccgggcgtgctctacgagctgaccgaggac
agccatgaactggaggcggtgtaccgcggaatcgaaagcctgatgacttatcacgggcag
gcgcatggcatgttctccggcgacgaatggctgtcgggcacgcatccaagccaaggcgtg
gaattatgcgcggtggttgaatatatgtttacgctggagcagctgacccggattttcgga
gacggcaagtttgccgacgtattggaaaaggtagcctttaacgctttgcctgccgctatt
tcggcggattggacttctcatcaatacgatcagcaagtcaatcagattatttgcaacgta
gccccgcgcgcctggagcaacggtccttatgccaacgtctttggtttggagccgaatttc
ggctgctgcacggccaacatgcaccagggctggcctaagctggtttcccatttgtggatg
aaggataatgggggcgggttagctgccgtttcttatgccccttgtcttatccgcacggat
gtcgcgggcggcgtgaaagccgagcttcgggtatccggggagtatccgttccgggagcgg
gtaaaagtagagcttcagctggagcatccagccagctttgcggtacggctgcgaattccg
ggctggtgcgaagcgccggtcattacggtaaatggtaccgccgcttcgcttgagatcaag
caaggctatgcggccattaaccgtgaatggcagaccggagaccgcattgagctgacgctg
ccgatggagccgaagacggtatcccgcaatctgtatgccgtaagcgtagaacgcggaccg
cttgtttatgcccttcccgtggaagagagctggcagctgctgcgcaagcgcgaacgattc
catgactacgagctgtatccggcttccccttggaagtacggcctgcttgcggatagcacg
tttaaggcggttacgagcagcgaagaaattccgtaccagccgttcctggccgtagagtct
cctgttaagctcgccgtattgggccagctggtgccggattggcgaatggaaggcaataat
gcaggaactccgccaatcgcgccgaatacagatgatcagccggtcaccgagcttatgctt
gttccgtatggcggagcaaagcttcgaattggagaattcccgttaatcggcgaacgaaag
acatcaagaacacgataa

DBGET integrated database retrieval system