KEGG   Paenibacillus sp. JDR-2: Pjdr2_5029Help
Entry
Pjdr2_5029        CDS       T00977                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC AraC_binding
Motif
Other DBs
NCBI-ProteinID: ACT03640
UniProt: C6D0P1
Position
5754502..5755380
Genome map
AA seq 292 aa AA seqDB search
MFHFECPPMPHFVQIGEDTYQIGRKHPDRSSIGVFDLLLVTRGCLYLAEGENELTLPAGN
FGILRPDLEHHTVIPCREETHFYWLHFQTTGQWHPEPYDKEPLPPEQEPLYPPIEYFSFY
LPRSGPVQSLGRGEEQFRELLQLYENPAGNSRWQEQQLFHAILLKLQEDSKEETTQSSHL
QLAEDAALYLRKHYRDPLSYKRMAEELHFHANYIALCMKRTFGCTPLDYVTQYRIEQAKR
LLIHTNEPVGTIAEDTGFGSFPYFVRCFHKRTGKTPKQFRMLYRQSKPPAST
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtttcattttgaatgtccgcctatgccccattttgttcaaatcggagaagatacgtac
cagatcggcagaaaacatcccgaccgcagcagcatcggcgtatttgatctcctgcttgta
accagaggatgtctgtatctggcagagggggagaacgagctcaccctgccagccggtaat
ttcggcattttgcgtccggacttggagcatcacaccgttatcccttgcagggaagagacc
catttctactggctgcatttccagacgaccggacagtggcatcccgagccttacgacaaa
gagcccttgccgcctgagcaagagcctctttatccgcctatcgaatacttctccttttat
ttgccgcgctccggcccggtacaaagcctcgggagaggagaagagcaattccgcgagctt
cttcaactgtatgagaatccggccggaaattcccgctggcaggagcagcagctgtttcac
gcgattcttcttaagcttcaggaagacagcaaagaagagacaacgcaaagctcccatctg
cagctggccgaggatgccgccctctatttgcgcaagcattaccgcgacccgctgagttac
aagcggatggctgaggagctgcattttcacgccaactatatcgccttgtgcatgaaaaga
acgtttggctgcacgccgcttgactatgtcacccaataccggatcgaacaagccaaacgg
ctgcttattcacaccaacgagcctgtcggcactattgcggaggataccggctttggctcc
ttcccgtatttcgtccgctgctttcacaagcgaaccggcaagacgccaaagcagttccgg
atgctgtaccgtcagagcaagccgcctgcttctacctag

DBGET integrated database retrieval system