KEGG   Paenibacillus sp. JDR-2: Pjdr2_5038Help
Entry
Pjdr2_5038        CDS       T00977                                 

Definition
(GenBank) transcriptional regulator, GntR family with LacI sensor
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 GntR Peripla_BP_1 Peripla_BP_4 HTH_41 DnaI_N
Motif
Other DBs
NCBI-ProteinID: ACT03649
UniProt: C6D121
Position
complement(5764201..5765352)
Genome map
AA seq 383 aa AA seqDB search
MNESSKPMYERIFEALREDIIEKKYIPGDRVPSEKELGDEYNVSRITSKKALELLANEGY
IIRQPGRGSFVSDQPAPQPKQPAAAGAIAQKARKEDGKLLIGLVITDFADSYGNGLIYGM
EEASRHHNCYLVLRRTFGMPALEEEAIKGLLELGVDGLIIFPAQGEYFNAEILKLVINQF
PFVLVDRHLKGISASSIATDNVGAAKDGTNHLFELGHKSIAFLTPPPVDTTAIEERIEGF
IQAHAEKGIVVDREVWMENITSTLPKHNTEENKQEDIQKIISHLNKHPQITALFATEYNI
GQIAFQAVQQMGKSVPRDYSIICFDCPETNGRYPFTHLSQNQHEMGRVAFENVLKLWAGQ
SVPNKILLDASLVVSDSTGPAQS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaatcatcgaaaccgatgtatgaacggattttcgaagcactccgcgaagacatt
atagagaagaaatatataccgggcgaccgggttccttcggagaaggagctgggcgacgaa
tacaatgtcagccggattacgagcaagaaggcactggagcttctggctaatgaaggctat
attatccggcagccgggacgcggctccttcgtatcggatcagcctgcgccacagccgaag
cagccggcagcggcaggtgcgatagcccagaaagcgcgcaaggaagacggcaagctgctg
attggtctcgtgattaccgactttgcggacagctacggcaacggactgatttacggcatg
gaggaagcatcccgccatcataactgctacctggttctccggcgcacgtttggcatgcct
gccctcgaagaggaggcgatcaaaggtctgcttgagcttggcgtggacggacttattatt
ttcccggcacagggcgaatacttcaatgccgaaatcttgaagctggtcattaatcagttc
ccgttcgtgcttgtcgaccgccatttgaagggcatttcggccagctccattgccacggac
aatgtaggcgccgccaaggacgggactaaccatctgtttgagcttggacacaaatcgatc
gcctttttgacgcctccgccagtggatacaaccgccattgaggaacggattgaagggttt
attcaagcccatgcggagaaagggatcgttgttgaccgggaggtctggatggagaatatt
acgtctacgcttccgaagcataatacggaggagaacaagcaggaggatattcaaaagatt
atcagccatctgaacaagcatcctcagattacggcattgttcgcaaccgaatacaacatc
ggccagatcgccttccaagcggtgcagcaaatgggcaagtccgtgcctagggactattcg
attatctgctttgactgcccggagaccaatggacgttatccgttcacgcatctgagccag
aatcagcatgagatggggcgagttgctttcgagaacgtgctcaagctgtgggccgggcaa
tccgtaccgaataaaattctgctggatgcttcgcttgttgtcagcgactcgacaggtcca
gcccaatcataa

DBGET integrated database retrieval system