KEGG   Paenibacillus sp. JDR-2: Pjdr2_5047Help
Entry
Pjdr2_5047        CDS       T00977                                 

Definition
(GenBank) protein of unknown function DUF1037
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThuA
Motif
Other DBs
NCBI-ProteinID: ACT03658
UniProt: C6D130
Position
complement(5779650..5780381)
Genome map
AA seq 243 aa AA seqDB search
MKQIKVTVWNEYRHEKHNEHVKGIYPEGIHNAIGGYLKTIEGLEVGTATLDEPEHGLTDE
VLNNTDVLIWWGHLAHHEVRDDIAEKVRDRVLQGMGLIVLHSGHASKVFEKLLGTKTGAL
KWRDDGEKERLWVIEHGHPIADGLGEFIEIPKEEMYGERFEIPAPDELVFISWFEGGEVF
RSGCCYRRGKGKLFYFRPGHETFPIYHQPEILHVIKNAVHWAAPTQGAAAAYGRVEPLEN
ISK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaataaaagtaaccgtatggaacgagtatcgccacgagaagcataacgagcat
gtaaaaggcatctatccggaaggcattcataatgccattggcggatatctgaaaacgatt
gaaggccttgaggttggaaccgctacgcttgacgagccggagcatggtcttacggacgaa
gtactgaacaacaccgacgtgctgatctggtgggggcatctggcccatcatgaagtgcgg
gacgatattgccgagaaggtaagggaccgggtactgcagggcatgggactgattgtcctt
cattcgggccatgcctccaaagtgttcgagaagctgcttggcacgaagaccggcgcgctc
aaatggcgggatgacggcgagaaggaacggctgtgggttattgagcacggccacccgatt
gccgacggccttggcgaattcatcgaaattccgaaggaagagatgtacggcgaacgcttt
gagattccggcaccggatgagctggtgttcatctcctggttcgaaggcggcgaagtattc
cgcagcggctgctgctaccgcagaggcaaagggaagctgttctacttccgtccggggcat
gaaacgttcccgatttatcatcagccggagattcttcacgtaatcaaaaatgccgtacat
tgggcggctccgacgcaaggcgcggcagcagcttacggacgcgtagagccattagaaaat
ataagtaaataa

DBGET integrated database retrieval system