KEGG   Paenibacillus sp. JDR-2: Pjdr2_5065Help
Entry
Pjdr2_5065        CDS       T00977                                 

Definition
(GenBank) glycoside hydrolase family 2 sugar binding
  KO
K01192  beta-mannosidase [EC:3.2.1.25]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Pjdr2_5065
Enzymes [BR:pjd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.25  beta-mannosidase
     Pjdr2_5065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2 Glyco_hydro_2_N Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: ACT03676
UniProt: C6D148
Position
complement(5804772..5807243)
Genome map
AA seq 823 aa AA seqDB search
MRSVTLNGNWTMKRTDEAEWNNAVVPGSVFHDLMSAGKMEDPYYRDNEYDILELTKFDYE
YRRSFLVDGDLLRMDRVLLRCEGLDTLCEVYVNGQAVLNTDNMHRTYEADVKGLLTEGSN
DIHVIIRSATNFVLAKDKELFLTSCADAVPGISHLRKAHSMFGWDWGPQLPDMGIWRDMS
LCGFNIGRIDDVYITQQHGDNNVKVNIAAELQRWSSDESLALYATIETPDGRTLEASVSE
AGEISNLVIDVQDPELWWPNNLGSQPLYGLRVELRSGDRLLDERSLSIGLRTLHVVRQPD
KWGESFAFEINGHQIFAMGANFIPEDNIFGRRSNERTEQLIQSCVEANYNCIRVWGGGYY
ADDYFYDLCDRHGLIVWQDHLYACGAYDFNDEFKENIRLETIDNMKRIRHHASLGLWSGN
NELEYAWAYWGWTERYGEKQRDDYLKQFEEFLPVLSQSLDPNTSYLVSSPSSKGGIDDPN
NEDIGDMHYWDVWHGRKPITEYRTLHPRFMSEFGLQSFPSIKTVETFTLPEDRNIFSRVM
EAHQKNGTGNEKIMYYISEYFKYPRNFEKLLYVSQLIQAEGMRVGVEHWRRNRGRCMGAV
YWQLNDIWPGASWSSLDYFGRWKATHHAAKRFFAPVLASALEEGTTVSLHVTNETLQTVS
GQLRWRLLDRKSETIQFGEAEVTLDALASEEIVSLDFSETLTTKQLLSQSYLAFEFVMGE
ETISEGTALFVKPKHFELLNPEIRAAVAEEDDRFVVTLDSRAFAPFVLLELSHADARWSN
NVFALSADRQAVVTVPKDGLSEPLSLAAFREQLVVTSLYDTFE
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcagtaacgctaaacggcaattggacgatgaaaagaacggatgaagcggaatgg
aacaacgccgttgttccgggctccgtattccatgatctaatgtctgcgggtaagatggag
gatccttattaccgcgataacgaatacgatattttagagctgacgaagtttgactatgaa
taccgccgcagcttcctcgttgacggggatctgctgcggatggaccgcgtgctgctccgc
tgcgaagggctcgatacgctttgcgaggtttacgtaaacgggcaagccgtattaaatacg
gacaatatgcaccggacatacgaagcggatgtgaaggggctgctcactgaaggcagtaac
gacattcacgtcattatccgctcggccacgaactttgtgcttgcgaaggataaggagctt
tttctgacgagctgcgccgacgccgtgccgggcatctcgcatctgcgcaaggcgcatagc
atgtttggctgggattggggtccgcagctgccggatatgggcatttggcgggacatgtcc
ctctgcggatttaatatcggccggatcgatgatgtctacatcacgcagcagcatggcgac
aataacgttaaggtgaatatcgccgcggaattgcagcgctggtcctctgacgagtctctt
gctctttatgctacgatcgagacaccggatggaaggacgctggaggcgtcggtaagcgaa
gctggcgaaatctccaaccttgtgatcgacgttcaggatcccgagctatggtggccgaac
aatctcggaagccagcctttatacgggttgcgggttgaattgcggagcggagaccggctt
ctggatgaacgctcgctgagcatcggactccggacgctgcatgtcgtgcgccagccggat
aagtggggcgagtcgtttgcgtttgaaatcaacggtcatcagatcttcgcgatgggcgcc
aattttattccggaggacaacatcttcggtcggcgcagcaacgaacggacggagcagctg
atccaaagctgcgtcgaggctaactacaactgcatccgcgtctggggcggcgggtactac
gcagacgattacttctacgatctgtgcgaccggcacggcctgatcgtgtggcaggatcac
ttatacgcatgcggagcttacgattttaacgacgagttcaaggaaaatatccggctcgag
acgatcgacaatatgaagcggatccgtcaccatgcctcgctgggcctctggagcgggaac
aacgagctggaatacgcctgggcgtattggggctggacggagcgctacggcgagaagcag
cgcgacgattacctgaagcagttcgaagagttcctgccggtgctgtcgcagtcgcttgat
ccaaacacctcttatttggtgtcatcgccatcctccaagggcggtatcgacgatccgaat
aacgaagacatcggcgacatgcattattgggatgtctggcacgggcggaagccgataacg
gaataccggacgcttcatccccgttttatgtccgagttcggtttgcagtcgttcccgtcc
attaagacggtcgagacgtttacgctgccagaagaccgcaatattttctcgagggtcatg
gaagcacatcagaagaacggcaccggcaacgaaaagatcatgtattacatcagcgaatat
ttcaagtatccgagaaacttcgagaagctgctgtacgtctcccagcttattcaggccgaa
ggcatgcgggttggcgtggagcattggagacgcaaccgcggcagatgcatgggggcggtc
tactggcagcttaacgacatttggccgggcgcatcctggtcaagcctggattacttcggc
agatggaaggcgacgcatcatgccgccaagcggttctttgcgccggtgcttgcatccgct
ctggaagaagggacaacggtatcgcttcacgtgaccaacgaaacgctgcagactgtaagc
gggcagctccgctggagactgctggaccgcaagtcggagacgattcaattcggcgaagcc
gaagtaacgcttgacgctctcgcttcggaagagatcgtctcgctggacttctcggagacg
ctgacgaccaagcagctgctcagccaaagctatctcgctttcgaatttgttatgggcgaa
gagacgatcagcgagggtacggcactgttcgtgaagccgaagcatttcgagcttctcaat
ccggagatccgcgctgctgtcgcggaggaagacgaccgttttgtcgttacgctggacagc
cgggcgtttgcaccttttgttctgttggaattaagccatgccgacgcccgctggagcaac
aacgtatttgctctttccgccgaccgtcaggccgttgtgacggtaccgaaggacggcttg
tccgagccgcttagcctggctgcgttccgcgagcagctcgtcgttacaagcctatacgat
actttcgaataa

DBGET integrated database retrieval system