KEGG   Paenibacillus sp. JDR-2: Pjdr2_5070Help
Entry
Pjdr2_5070        CDS       T00977                                 

Definition
(GenBank) extracellular solute-binding protein family 1
  KO
K17318  putative aldouronate transport system substrate-binding protein
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd02010  ABC transporters
Module
pjd_M00603  Putative aldouronate transport system
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Pjdr2_5070
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pjd02000]
    Pjdr2_5070
Transporters [BR:pjd02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative aldouronate transporter [MD:M00603] [OT]
    Pjdr2_5070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: ACT03681
UniProt: C6D153
Position
complement(5813201..5814748)
Genome map
AA seq 515 aa AA seqDB search
MKQMTKKLSLAATTVVLAGSLAACSSNNNGNDAAASNAPSASANTASTEPGGNLPTLKRL
DVFQGEDYANYPVAKLLEEKTGYKVQYDMLPQDNPAQKLNLLMASGEPYDIVTSYIDMAL
YSDYAKKGALIDLTPLIDQFGPNIKNAISQQSMDALKVDGKLYGIPNIITYPVGFGILIR
TDWLDKVGLQMPTTTGEFQAALQAFKDKDPGGNGSQNVPFTVKGDLPMIDDLVGAFGMPN
PWNVVDGQLVPRVLDPAFPDYVKYVSGLYSGGLLDKEFVVNKDATAKEKFSSGKAGAIVV
HWADIPGISDALAKAAPDAKFAYVPALKGPNGKSGFGANQGFDRLSFVPKSSKHPEDAVK
WINASLESATFKEVAIGVEGTHYTVDNGSYNPILPIFNDERNLANNYMVGTDEANYPQYW
QARVRKNPVMFEAFDTLNNKTADSDKILNVLSVAPYLENYSKNNLKLETMSGDYTVKLIA
GSEKLDGLGDFQKKYNAEGAEASAKEINDWYKTTK
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaatgacaaaaaagctttcacttgcagcaacaacggttgttctggcgggctca
ttagcggcatgctcgtcgaataacaatggcaatgatgcggcggcatccaatgcgccgtca
gcatccgctaacacggcttcaacggagcccggcggcaatcttccgactctgaaacgtctg
gatgttttccaaggcgaggattacgccaattatccggtagcgaagctgctcgaagagaaa
acaggctacaaggtgcaatacgatatgcttccgcaggataatcccgcgcaaaagctgaat
ctgctcatggcttccggcgagccctacgatatcgtaacctcttacatcgacatggctctg
tattcggattatgcgaagaaaggcgcgcttattgatttaacgccgctgatcgatcaattc
ggtcccaacatcaaaaacgcgatttcgcagcagtcgatggatgccttgaaggttgacggc
aagctgtacgggattccgaatattattacttatccggtaggcttcggcattctgatccgt
acggattggctggataaggttggcctgcagatgccaacgacaacgggcgaattccaggcc
gcgctgcaagccttcaaggacaaggatccgggcggcaacggcagccagaacgtgcctttt
acggttaaaggcgatttgccgatgattgacgatcttgtaggcgctttcggcatgccgaat
ccatggaatgtggtggacggacagcttgtgccgcgcgtgcttgatccggccttcccggat
tacgtgaagtacgtttccggactctattcgggcggattgctcgataaagagtttgtcgtc
aataaagacgcaacagccaaagagaaattctccagcggcaaagcaggcgcgattgtcgtt
cactgggctgacatcccgggcatctccgatgcgcttgccaaagctgcgcccgatgcgaaa
tttgcttacgtaccggctcttaaaggtcctaacggcaaatccggctttggagcgaatcaa
ggctttgaccgtctgagctttgttccgaaatcctccaagcatccggaggacgcagttaaa
tggattaacgcaagccttgaatcggcaaccttcaaagaagtagcgattggcgtggaaggt
actcattataccgttgataacggctcttacaatccgattctcccgatcttcaacgacgag
cgcaacttggcgaacaactacatggtcggaacggacgaagccaactatccgcaatactgg
caggcccgcgttcgcaaaaatccggttatgttcgaagccttcgatacgctgaacaacaaa
acggccgattcggataaaattcttaacgtgcttagcgtagctccgtatttggagaactac
tcgaaaaataatttgaagctcgaaacgatgtccggcgattacaccgttaaattgattgca
ggcagcgagaagctggacggccttggcgacttccagaagaagtacaatgccgaaggcgcg
gaagcgagcgctaaagaaattaacgattggtacaaaacaaccaaataa

DBGET integrated database retrieval system