KEGG   Paenibacillus sp. JDR-2: Pjdr2_5074Help
Entry
Pjdr2_5074        CDS       T00977                                 

Definition
(GenBank) NADH:flavin oxidoreductase/NADH oxidase
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN Dus His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACT03685
UniProt: C6D157
Position
complement(5817044..5818075)
Genome map
AA seq 343 aa AA seqDB search
MKHLFTPYEIKSLSLKNRVVMPPMCQYSVTAKGGIANDWHYAHYVSRAVGGAGLIIIEMT
DVEPDGRITDYDLGLWSDDHIPALARIVEAVHQHGAKIGIQIAHAGRKAEDAELPVAPSA
IPFDENSKTPRALTTEEAEQMVEKFRLAVRRAVQAGVDTIEIHGAHGYLIHQFVSPLTNK
RADKYGQDRTLFGKEVIKAAKSEMPAHMPLFMRISAREYAEGGYGINESIAFAKEFKEAG
VDVFHISAGGEGQIAAAGRPGTHAGYQVPLARAIREALDIPVIAVGRLDDPALANSVIGN
EDADLVAVGRGMLRNPYWALEAASVLHKEIEVPRQYDRGFARG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcacttatttactccgtacgagattaaaagcttgtccttgaaaaaccgcgtcgtt
atgccgccgatgtgccaatactcggtaacggccaaaggcggcatcgcaaacgattggcat
tacgcgcattacgtcagccgcgcggttggcggcgcgggattgattattatcgaaatgacc
gacgtcgagccggatggccggattacggactatgatttgggattgtggtcggatgatcat
attccggcgctggcacgcatcgtggaggccgtccatcagcacggggcaaaaataggcatt
cagattgcccatgccggccgtaaagccgaggacgcggaactgccggtagcaccgtcggct
attccgtttgacgaaaattcaaaaacgcctcgtgctctgaccactgaagaagcggagcaa
atggtggagaaattcagactggctgtacgccgtgccgttcaggctggcgtggataccatt
gaaattcatggtgctcacggctatctgatacatcagttcgtgtccccgcttacgaacaaa
agagcggataaatacggccaagaccggacgttattcggaaaagaagtgattaaagccgca
aaaagcgaaatgcctgcccacatgccgttatttatgcggatctccgcccgggaatatgca
gaaggcggctatggcattaacgaaagcatcgcgtttgcgaaggaattcaaagaagctggc
gttgacgtcttccatatcagcgctggcggggaagggcaaatcgcggccgcgggcagaccg
ggcacgcatgcgggttaccaggtgcctctcgcgagagcgatcagagaagcactggatatc
ccggttatcgcagtcggcagattagacgatcctgcgcttgccaattccgtgatcggcaac
gaagacgcggatcttgtggccgtaggccggggcatgcttcgcaatccttactgggccctc
gaagcagcaagcgttctccacaaagaaatcgaagttccgagacaatacgatcgcggcttc
gcgcgcggttaa

DBGET integrated database retrieval system