KEGG   Paenibacillus sp. JDR-2: Pjdr2_5075Help
Entry
Pjdr2_5075        CDS       T00977                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_1 LysR_substrate
Motif
Other DBs
NCBI-ProteinID: ACT03686
UniProt: C6D158
Position
5818294..5819154
Genome map
AA seq 286 aa AA seqDB search
MVDFEWYRSFIAIYKHHSVSEAAKTRMMTQPAMSQHLAALEAEVGEALFTRVSRRLAVTE
RGKELYSRVAPLVESLEETTAGLKSTSLPNNKVFRIGLSLEYFQELFLPKVTNSGMCSVS
YFGTADQLLELLKEDQVELIITPKKFIVPGIEYELLMEETFTIITPASLEIPDLRHPKEI
EEWLSEQRWISYGLELPIIRRLWREHFKRRPLIKPKHVIPNLHAVIRAVEMGAGISVIPT
YLLEHSKAGIHTCFDNLTVTNDLLIGYKSKHKHLPELQEIISIIRR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggtcgattttgaatggtatcgaagctttattgctatatacaagcatcactccgtctcc
gaagccgccaagaccagaatgatgacgcagcccgccatgagtcagcatttagccgcactg
gaggctgaagttggagaagcgttattcacgcgtgtatcgaggagacttgccgtaaccgaa
cggggcaaagagctgtactcccgggttgcgccgctagttgaatcgctggaggaaacaacg
gccgggctgaaatccacgtccctgccgaacaataaggtgttccgcatcggcttatctctg
gagtattttcaggagctgtttcttcccaaggttacgaattccggcatgtgcagcgtctct
tacttcggaactgctgatcaattgcttgagctgttaaaggaagatcaagtggagcttatt
attactcccaagaaatttatcgtgcccggcattgagtatgagctgttaatggaagagacc
tttacgatcataacgccggcttcgctcgagatccccgatcttcgccatcccaaagagatc
gaggaatggctgtccgagcagcgatggatttcctacgggctggaactccccataattaga
cgcctatggagagagcatttcaagagacgtcctctaatcaagcccaagcatgtgattccc
aacctgcacgcggttattagagccgtcgagatgggcgccggaatcagcgtgatccctacc
tatctgcttgagcattcgaaggccggcattcatacctgcttcgacaatttgactgttact
aatgatctgttaatcggctataaaagcaagcacaagcatctgcccgagctgcaggaaatt
atttcgattatccggagatga

DBGET integrated database retrieval system