KEGG   Paenibacillus sp. JDR-2: Pjdr2_5076Help
Entry
Pjdr2_5076        CDS       T00977                                 

Definition
(GenBank) Alpha-L-fucosidase
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F5_F8_type_C Glyco_hyd_65N_2 SLH fn3 DUF1565
Motif
Other DBs
NCBI-ProteinID: ACT03687
UniProt: C6D159
Position
complement(5819202..5826803)
Genome map
AA seq 2533 aa AA seqDB search
MILKCKQASSLVRILLCAVLCSSAFGSLIKPPAVSADPSSSTGQTLHVAKNGSDSNPGTE
AEPFLTINHAAELAQPGDTVLVHAGLYRETVKPARGGTDEAHRITYTNAGDGEVVIKGSE
EIDSWTPYSGDVWRVTLPNSYFGSYNPYSTRHPQGGEGNFFPGYTAGDVYLNEQAYYEKP
SLNNVLSAADTWYTEVSADTTTIYANFDGADPNGKLAEINVRKQIFAPDAWGLGYITVDG
FTVKHAANTYSDFPGVPSRGQAGAISVNGGLKWIIQNNIVINARTIGIDIGLGNDEWAGN
RPGNTRTDFHDTDKYGSHIVRNNYIAKCGQSGIAGVFSWNSDILYNRIEDTNYRGEFSGA
ETAPIKVHYMNEGLIKGNYIKNSKGGNSAGIWTDWGNQNVRITGNIVMNAPWGYYAEAVH
GPILVDNNVFIGNSDIRMLDATGVVFANNLFIDNGNINVDGGGRDNYYFEPGTMNETSSV
NAVQKFFWYNNLVQGSVLPSDAANKTHVKEGNFTNVVSDAAYTATNTDLSLSFNLNASGI
NGLTPVTQSRVGLIPEANESIAADVTTDFFGNDVNAGNMMAGPFADAHNGANTYVLWPPQ
GQTVPTPPAPPVDVPVNLSLKPGVTVTASYEDGSYTAAKAIDGNGSTRWSTDHSNDNNAW
ISVDLGDVYNVSKVVLSWEAAYAKEYKIQISDDGEHWTDAYHTASGGGGNETVTIRKDTR
HIRMQGIQPQTAYGYSLYELEVYGTPAEPEVAVNVALNKAPSAYTASSQSNDGSGETNSQ
PDKDRSAFRAFDGNPATRWGSNGGDDNWLQVDLGKTHVIDKVVLMWEAAYASEYKIQVSE
DGSAWTDVYSRNDASVTGDHTDEIQLDQPAEGRYVRMQGVKAATQWGLSLYEFEVYGKVK
PADTAPEWPSAALLAATSVTDSSAAVQWPSAVDNQAVTGYKVYLGTTLVGSLSSGEHAYT
LNGLTAGKTYTVKVTAVDAAGNESKGLTGSFTTSGNPATKALSTTYPQNYGDWEDGLLAG
NGKQGIIVFGNPRNDTVIFDDKDFFMARTEARPNRTFNTVSEANIQKIRDWLIQGKYQEA
NQLAADVQGYQNGGEGSKHPGYKMTITMPDTGEITNYVRSTDYSAGVVSVNWSDDRGDWE
RDSFVSRPDGVTVQYMPAPAGKTLDVKLALSIDPGMNLLNKGVTFQNNSNAEFLNLRAKY
ANGSYNAGYEGVTRVITDGTKVMEGDAVSVSGATYVLLLSLTQRYDGTYQGGLPAEQEWN
KELLQSKLSGITDDYETLLDRQVSEHSQIFDRVSFDLGASPEDRSKSNEQLLAMQKQSAT
PIPALYERMFYSGRYHLLGSSNETAAPDLLGNWTGDSNVGWDGYYHLDANLNLQISGGNI
GNMPEAMAGYFYLNKQWQNDFRTNAEKLLGTRGMLTGGNTPNGEGLISNINFDYPYQYVT
GGESWLLYPFWEYYEISGDKDFLENQYYPLIRDMGDFYEDFLVEKDGNGKYIFAGSISPE
NRPAGGVPLSVNSVYDISGARFALETLIETSKLLGKDQDKIPVWQEKLDNLPPYLVNNDG
ALAEWAWPDLMNKNNYQHRHSSGLMPVWPYKEVTPEKNKALYDAAKVFLNKKDGGNYENA
GHGLLHGALIAANLNDADSVNAKLLRFAKDDYYYTSLATSHYNNHGTFATDVVNSVPTIM
MEMLATSEPGTLELLPALPKDLKKGSISGILGKSQFTINNLSWDMNQRKVTVQLTSAIDQ
DLTLIQRAGIEQISSDDAQIRTSPIGNIARVLPLKANEPVTVQMTIKDAAKINLAQGKTA
SASSESNGQQTADKAFDGDSSTRWGAGEAADNFIQVDLGGIYSLNEIVLQWEASYAKGYK
LQTSMDGVNWSDIYEQANSQGGREQIPVDAVGRYVRMQGMEKSGQWGFSLYEMEVYGQEA
PNIALGKPSQASSASNAQQAAAAAFDGDKSTRWSASESAANWIQVDLQNTYNVYRVAIDW
EDSYAKGYKLQSSPDGQAWTDVYTETNSNGGTDIIDLNTAARYIRMQGVEKSGQWGYSIY
EMKVYGTQQPAQLTAQEVADGITAIASPAQDATALTMPSVPAGFQAAIKSSSHPDVVGLN
GVITPPAAETTVSLVLTVTRTSDNSAADTISLTVTVPAKSGDGNTGGNNGGNGGTGGTGG
TGGTGGTGGNGGTGTSPTQTYEVKAGELANLPANGKAVVQIPADIRHVVLPSQAASLPAG
SRIILRAAQVELELPAELLKQWQQSTTQGNQMVVDLDWLPQESASKQLGSLPDQTQATLA
GTFVLGLSKLTAFAHPVIVHLKGDAAINPKLAGIYKLNANSEPVYIGGSYENGQWTFEAN
DPGSYALIETVWNYNDVPSGYWAKDVIQQLAAKHIINGTGGGSFAPGRAVTRAEFAALLV
RALKLEGDGGTVFADVSSDAWYAEAVAIASNAGIVTGKGGGKFDPNAQITREEMVTMLMR
AFLDKGTAEGNKDATFHDQQDISSWASEYVEQASELGLIKGRSAGIFDPRGIATRAESAQ
IIFNLLGAKNIIN
NT seq 7602 nt NT seq  +upstreamnt  +downstreamnt
atgattctcaagtgtaagcaagcttctagtctagtcagaattctgttatgcgccgtgtta
tgctcgagtgcgtttggttctctgattaaaccgccggccgtgtcggccgatccttcttca
agcacggggcaaacccttcatgtggcgaaaaatggaagcgattccaatccaggtacggag
gcggagccgttcctgaccattaatcatgcggcggagttggcgcagccgggcgacaccgta
ctggtgcacgccggcctgtatcgcgagacggtaaaaccggcgcgcggcggtacggacgaa
gcgcaccgcatcacttacacgaacgccggtgacggcgaagtcgtgattaaaggctccgag
gagatcgattcctggacgccttacagcggagacgtatggcgcgttacgctgccaaacagc
tatttcggcagctacaatccgtactcgacacgccatccgcaagggggggaagggaatttc
tttccgggttatacggctggcgacgtttatttgaatgagcaggcttattacgagaagcct
tccttaaacaacgtattatcggcggccgatacctggtataccgaggtttcggccgatacc
acaacgatttatgccaatttcgacggcgccgatcccaacgggaagcttgccgaaatcaat
gtgcgcaagcaaatttttgctccggatgcatggggcctgggctatattacggtggatggc
tttacggtcaagcatgcggccaatacgtattccgattttccgggcgtgccttcaagagga
caagccggggcgatcagcgtaaacggcggtctcaaatggatcattcagaataatatcgtt
atcaatgcccgtacgatcgggatcgatatcggcctcggcaacgatgagtgggcaggcaac
agaccgggcaatacgcggacggatttccacgataccgacaagtacggctcgcatatcgtc
cgcaacaactatatcgccaaatgcggccagtcgggaatcgccggcgtattctcctggaat
tccgacatcctgtacaacaggatcgaggatacgaactaccgcggggagttcagcggagcc
gagacggcgccaatcaaagtgcattacatgaacgaaggcctcatcaaaggcaactatatc
aaaaactccaaaggcggcaactcggcaggcatttggacggactggggcaaccagaatgtc
cgcattaccggaaatatcgtcatgaacgcgccatggggatattacgccgaagcggttcac
gggccgattctcgtggacaacaacgtctttatcggcaacagcgatatccggatgctggat
gcgaccggcgttgtattcgcgaacaatctgtttatcgataacggcaatatcaacgttgac
ggcggaggcagggataactattatttcgagccgggcacgatgaacgagactagctccgtc
aatgccgtccaaaagttcttctggtataacaatctggtgcagggctccgttctgccgtcg
gacgcagcaaacaaaacgcatgtcaaagaaggcaacttcaccaatgtcgtatccgatgct
gcctatacggccaccaatacggacctcagcctgagctttaatctgaatgcttccggcatc
aacggattgaccccggtgacgcagtccagagtgggccttattccggaggcgaacgaaagc
atcgcggccgacgttacgaccgactttttcggcaatgacgtaaacgccggcaatatgatg
gccgggccattcgccgatgcgcataacggcgcgaatacttatgtcctgtggccgcctcaa
gggcagacggttcctacgcctccggcgccgccagtcgacgtgccggttaatctgtccctt
aagccgggcgtaacggtaaccgcttcttatgaagacggttcgtatactgcagcgaaggcc
atcgacggaaacggatcgacccgctggtctacggatcacagcaacgataataacgcatgg
atctcggtcgatctcggcgatgtatacaacgtatcgaaggtagtgctgtcgtgggaagcg
gcctatgcgaaggaatataaaatccagatctcggatgacggagagcactggacggatgcg
tatcataccgcttccggcggaggcgggaacgagacggtcacaatcaggaaggatacgcgg
catatccgcatgcaaggaattcagccgcagaccgcgtacggttactcgctgtacgagctc
gaggtttacggcacgccggcagaaccggaggttgccgttaacgtggcactaaacaaggca
ccttccgcttatacggcttcttcccagtccaatgacggaagcggggagaccaacagccag
cccgataaggacagatcggcgttccgcgcgtttgacggcaacccggcgacccgttggggc
tccaatggcggagacgacaactggcttcaggtggacctgggcaagacgcatgtgatcgac
aaggttgtcctcatgtgggaagcggcttatgcttccgaatataaaattcaggtatcggaa
gacggcagcgcctggacggatgtttattcccggaacgatgcttcggtaaccggagatcat
accgacgagatccagctggatcagcccgcggaaggccggtatgtccggatgcagggcgtg
aaggccgcgacgcaatggggtctctcgctgtacgaattcgaagtctacggcaaagtaaag
cctgccgataccgcgccggagtggccttccgccgctttgctcgccgcaacgtccgtaacg
gattcctccgcagcggttcaatggccgtccgccgtcgacaaccaggcggtaaccggctat
aaggtttatttgggcacaacgcttgtcgggagcttgtcttccggtgagcatgcttatact
ttgaacgggctgaccgcagggaaaacctatacggtgaaggtgacggccgtagatgcggcg
ggcaatgagagcaagggactgaccggctcgtttacaacctccggcaatcctgcgacgaag
gctttgtccaccacttatcctcagaattacggcgactgggaggacggcttgcttgccggc
aacggtaaacagggcataatcgtgttcggcaatccacggaatgacacggttatttttgac
gacaaggatttctttatggccagaacggaagcccgtccgaacagaaccttcaatacggta
agcgaggcaaatattcaaaaaatccgggattggcttattcaaggcaaataccaggaagcg
aatcagctggccgccgatgttcagggttatcagaacggcggggaaggcagcaagcatcct
ggctacaagatgaccattacgatgccggacaccggtgaaattacgaactatgtccgttcc
acggactattccgccggagtcgtatcggtcaattggtcggatgaccggggcgattgggaa
cgcgactccttcgtatccagaccggacggcgttacggttcagtatatgcccgcaccggca
ggcaagacgctggacgtgaagcttgcgcttagcatcgatccgggcatgaacctgctgaat
aaaggagttacgttccagaacaactccaatgcggaattccttaatctgcgggcgaaatac
gcaaacggcagctataatgccggctacgagggagttacgcgcgtcattaccgacggcacc
aaagtgatggaaggcgatgcggtgtcggtatccggcgcaacctatgtgctgctgctgtcc
ctcacccagcgttacgacggcacttaccaaggcggtcttcccgccgaacaggaatggaat
aaggagctgctgcaaagcaagctgtccggaataacggacgattatgaaacgctgctggat
cgtcaagtgagcgagcatagccagatttttgaccgcgtgtcctttgatctcggcgcaagc
ccggaagaccgctcgaagtccaatgaacagctgctcgccatgcagaagcaatccgcgact
ccgattccggccttgtacgagagaatgttctactccggccgctaccacctgcttggatct
agcaacgagacggccgcgcctgacctgctcggcaactggacgggggacagcaacgtcggc
tgggatggttactatcatttggacgccaacttgaacctgcaaatttccggcggcaatatc
ggcaatatgccggaggcgatggccgggtacttctacctgaacaaacagtggcagaatgat
ttccgaacgaatgccgagaagctgcttggcacaagagggatgctcaccggcggcaatacg
cctaacggcgaagggctgatctcgaacatcaacttcgactatccgtatcaatacgtaacg
ggcggagagtcttggctgttgtatccgttctgggaatattacgagattagcggcgacaag
gattttctggaaaatcaatattatccgcttatccgcgacatgggggatttctatgaagat
ttccttgtggaaaaagacggtaatggcaaatatatctttgccggatccatctctcctgag
aaccggcctgctggcggagtgccgttgtccgtcaactccgtttacgatatctccggcgcg
cgcttcgcactggagaccctgatcgagacaagcaagctgcttggcaaggatcaggacaaa
ataccggtctggcaggagaagctcgacaatctgcctccgtatctggttaacaacgacgga
gcgctggctgaatgggcatggccggatctgatgaacaaaaacaactatcagcatcgtcac
tccagcggcctgatgccggtctggccttacaaagaggtaacgccggaaaaaaacaaagcc
ttgtatgacgcggctaaagttttcctgaacaagaaagacggcggcaattacgagaacgcc
ggtcacggcttattgcacggcgcgcttatcgcggccaatctgaatgatgcggattccgtg
aatgcgaagcttcttcgtttcgcgaaggatgattattattacacaagcttggctacatcg
cactataacaatcacggaacttttgcgacggatgtcgtgaactccgtgccaacgatcatg
atggagatgctggcaacctccgagccgggaacgctggagcttttgccggccttgccgaaa
gatttgaagaaaggctcgatttccggcatcctcggcaaaagccaatttacgatcaacaac
ttaagctgggatatgaatcagcgtaaggttaccgtacagctgacttccgcgattgaccag
gatctgacgctgattcagcgcgcgggcatcgagcagatcagcagtgatgacgcgcaaatc
cgcacgtcgccgatcggtaatattgcgcgcgtccttccgctgaaggccaatgagccggtt
acggtacaaatgacgattaaagacgcggccaaaatcaatctggcgcaaggcaaaaccgcc
agtgcttcctccgaatcgaacggccagcaaacggccgacaaagcgtttgacggagactcg
tcaacccgctggggagctggcgaagccgcggacaactttattcaagtggatcttggaggc
atctattccctgaacgaaatcgtcctgcaatgggaagcttcctatgccaaaggctacaag
cttcagacctcgatggacggcgtgaattggagcgatatttacgagcaggccaactcgcag
ggaggcagggagcagattccggtggatgccgttggacgttacgtccgcatgcaagggatg
gaaaagtccggccagtggggcttctccttgtatgagatggaagtatacggccaggaagct
cctaatattgcgcttggcaaaccatcgcaggcttcctcggcatcaaacgcccagcaggca
gctgccgcagcctttgacggcgataagagcacgcgctggagcgcgagcgaatcggctgca
aactggattcaggtagacttgcagaacacctataacgtataccgggttgcgatcgattgg
gaggactcttatgccaaagggtataagctgcaatcctctccggacggtcaggcctggacg
gatgtatataccgaaacgaacagcaatggcggtacggatatcattgacctgaataccgct
gcccggtatatccggatgcaaggggtggaaaaatccggtcaatggggctattccatctac
gaaatgaaggtgtacggaacgcagcagcccgctcagcttaccgcgcaggaagtggcggat
ggcattacggccatagcttcccccgcacaagacgcgacagctttgaccatgccgtccgta
ccggcggggttccaggcagctattaagagcagcagccatccggatgtcgttggattaaac
ggcgttattactccgcctgccgcagagacgacggtcagcttggttctgaccgtaacgcgt
acatcggataactcggctgcggatacgattagtcttacggttaccgtgcctgccaagtcc
ggtgacggaaacacgggcggcaataacggcgggaatggcggtacaggaggtacaggaggt
acaggaggtactggcggcaccggcggtaatggaggtacgggaacatctccgacccagacc
tatgaggtaaaggcaggagaattagctaatctgccggcaaacggtaaggccgtggtacag
attcctgctgatatcaggcatgtggtgcttccttctcaagccgcgtcgcttccggcggga
agccggattattctccgggctgcgcaggttgagctggagctgccggcagagcttctgaag
caatggcagcagagtacaacgcaaggcaatcaaatggtagtggacttggattggctgccg
caagagagcgcatctaagcagctgggaagccttccggatcagacgcaggcaacattagcc
ggaacgtttgttttgggcctgtccaagcttacggcgttcgctcatcctgtcattgttcat
ttgaaaggcgatgctgccattaatccgaagctggccggtatatacaagctgaacgcaaac
agtgaaccggtatatatcggaggcagctacgagaatggtcagtggacatttgaagcaaat
gatcctggcagctacgctctcatagagaccgtatggaattataatgacgtgccatccggt
tactgggcgaaagacgtcattcaacaattggcggcgaagcatatcataaacggaacaggc
ggtggctcgttcgcgccgggccgtgcggttacccgtgcagaattcgcggcattgctcgtg
cgtgcccttaagcttgaaggggatggaggtacggtgttcgcggatgtaagttcggatgca
tggtacgcggaagccgtcgcaattgcgtcaaatgcgggcatcgtgacaggcaagggcggc
ggaaaatttgatccgaatgcgcaaatcacacgcgaggaaatggtcaccatgttgatgcgc
gcctttttggacaaaggcactgcggaaggaaataaggatgccacattccatgaccaacag
gatatttcctcttgggcgtcggaatacgtagagcaggcatccgaacttggattaattaaa
ggacgttcggcaggtatatttgatccgcgggggattgctacccgagccgaatccgcacaa
atcatatttaatttgcttggtgctaaaaatataatcaattaa

DBGET integrated database retrieval system