KEGG   Paenibacillus sp. JDR-2: Pjdr2_5079Help
Entry
Pjdr2_5079        CDS       T00977                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K10118  raffinose/stachyose/melibiose transport system permease protein
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd02010  ABC transporters
Module
pjd_M00196  Raffinose/stachyose/melibiose transport system
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Pjdr2_5079
Transporters [BR:pjd02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter [MD:M00196] [OT]
    Pjdr2_5079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACT03690
UniProt: C6D162
Position
complement(5828811..5829695)
Genome map
AA seq 294 aa AA seqDB search
MSRSPSMKLSRFGLFGLLAPSVAIYTFIMIIPLALSFYYSLTDWTGGPTKNFIGLDNYKL
LLKDSLFWHSFKNNLIILALTLVIQMGLAFLLTTFFMSKALRLKEFHRTVIFFPVVLSAV
VVGFVWQMIYSHDYGILNAVLRSVGLESSIRAWLDDPKIVLYSVTLPLIWQYLGIPLMIF
VSAVHGISKDIYETSELDGCTGFKKAIYITFPLIYDTIKVVMMLSISSNMLVFSHIYVMT
GGGPGTSSMVLAQYAYKTSFGSMQLGYGSAVTIGMFIVSFGIILLFKRLAEVKN
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaagcccttctatgaaattatccagattcggactgtttggccttctggctccg
agcgtcgcgatctacacctttattatgatcatcccgcttgctctatccttctattacagc
ctgacggactggaccggcggaccaacaaagaacttcattggcctggataattacaaactg
ctgttgaaggatagtcttttctggcattcgttcaagaacaacctgattattctggctctt
actctcgttatccagatggggctggcatttttgctgacgaccttctttatgtcgaaggcg
ctgcggctgaaggagttccaccggaccgttattttctttccggttgtattgtccgcggtt
gttgtcggtttcgtctggcagatgatttacagccatgattacggcattctaaacgccgta
ttgcggtcggtaggtctggaatcgtccatccgcgcttggctggatgacccgaagatcgtc
ctgtattccgttacgcttccgcttatctggcaatatctcgggattccgcttatgattttt
gtttcggcggttcacggcatatccaaggacatatacgagacaagcgagctggacggctgc
acgggctttaagaaagcgatctatattacctttccgctaatctacgatacgattaaagtc
gtgatgatgctgagcatttcttccaacatgctcgtattcagccatatttacgtcatgacg
ggcggaggacccgggaccagctcgatggtgcttgcgcaatacgcctacaaaacctcgttt
ggcagcatgcagctcggctacggaagcgcggttacgatcggcatgtttatcgtgagcttc
ggcattattctgctgttcaagcggctggcggaggtgaaaaactaa

DBGET integrated database retrieval system