KEGG   Paenibacillus sp. JDR-2: Pjdr2_5084Help
Entry
Pjdr2_5084        CDS       T00977                                 

Definition
(GenBank) transcriptional regulator, BadM/Rrf2 family
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rrf2 HrcA_DNA-bdg HTH_Crp_2 HTH_11 TFIIE_alpha MarR MarR_2 TrmB HTH_24
Motif
Other DBs
NCBI-ProteinID: ACT03695
UniProt: C6D167
Position
5835623..5836048
Genome map
AA seq 141 aa AA seqDB search
MISSRFTVAVHILALVHINNGNVTSEYIASSVNTNPAVIRRIMSMLSKAGLISSQPGVIG
IKLQHPIADISLLDVYKAVELPEKKELFTLHQNTNEHCVVGKGIQQALSDPLRDAQQQME
QSLSRTTIEQIVKKILRQEHL
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcagccgttttaccgtagcggttcatatcctagcgcttgttcatatcaataac
ggaaatgttacttccgaatatatagcttcaagcgtcaacacgaatcccgctgttatccgt
agaattatgagtatgttaagcaaagcaggtcttatttcttcccagcccggagtcattggc
attaagctccagcatccgattgccgacatctctttgcttgatgtttataaggccgtcgaa
ttgcccgaaaaaaaggagctgtttacgctccatcaaaatacaaacgagcattgcgtagtt
ggcaaagggattcaacaagcattaagcgatccgctgcgcgatgcccagcagcaaatggag
cagtccctttcccggaccacgattgagcagattgtcaagaaaattttgcgtcaggaacat
ttgtaa

DBGET integrated database retrieval system