KEGG   Paenibacillus sp. JDR-2: Pjdr2_5086Help
Entry
Pjdr2_5086        CDS       T00977                                 

Definition
(GenBank) NmrA family protein
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase RmlD_sub_bind DapB_N adh_short 2-Hacid_dh_C IlvN
Motif
Other DBs
NCBI-ProteinID: ACT03697
UniProt: C6D169
Position
complement(5837490..5838248)
Genome map
AA seq 252 aa AA seqDB search
MKIVVIGGSGLIGKKVVSNLRDQGHEVVAASPSLGVNTITGEGLEEALSGAQVVVDVSNA
PSWEDQAVMDFFDKSTRNLLAAEANAGVSHHVALSVVGTERLLQSGYFRAKKNQEELIEN
ANIPYTIVRATQFFEFVGGIADVATEGESVRLPSALMQPIFSKDVANAVADFTLKPPANG
IVDVAGPDQIPMDEFIRRYFSVTQDKRQVITDAKALYYGSVEVNDQSLVPNGDRPVTITK
AHFQDYLSSLKN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgtagtgattggcggcagtggattgatcgggaaaaaagttgtaagcaacctt
cgtgatcaaggtcatgaggtcgttgcggcgtcaccatccttaggtgtcaatacgatcacg
ggcgaaggactcgaggaagcgcttagcggtgcgcaagttgttgttgacgtatcaaatgcg
ccgtcgtgggaggatcaggcggttatggatttctttgataagtcgactcggaatctcctt
gccgccgaagcaaatgccggcgtaagccatcatgttgctttgtcggtcgttggaaccgaa
cgccttcttcagagcggatatttccgtgctaaaaagaatcaagaagagctgatcgagaat
gccaacattccttatacgatagtccgcgcaacgcagttcttcgagtttgtcggcggcatt
gccgatgtggctactgaaggggagagcgttcgtttgccttccgcccttatgcagcctatt
ttctctaaagacgttgcgaacgcggtagctgattttactcttaagccaccggctaacggc
attgttgacgttgctggtccggaccagattccgatggacgaattcattcgacgatacttt
agcgtaacacaggataaacgccaggtgatcacggacgctaaggcgctttattacggttcg
gtcgaggtgaatgatcaatctctcgttccgaatggcgatagacccgtaaccattacgaag
gcgcatttccaagattatctcagcagtttgaaaaattag

DBGET integrated database retrieval system