KEGG   Paenibacillus sp. JDR-2: Pjdr2_5094Help
Entry
Pjdr2_5094        CDS       T00977                                 

Definition
(GenBank) ABC-type nitrate/sulfonate/bicarbonate transport systems periplasmic components-like protein
  KO
K02051  NitT/TauT family transport system substrate-binding protein
Organism
pjd  Paenibacillus sp. JDR-2
Module
pjd_M00188  NitT/TauT family transport system
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pjd02000]
    Pjdr2_5094
Transporters [BR:pjd02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   NitT/TauT family transporter [MD:M00188]
    Pjdr2_5094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMT1 Phosphonate-bd SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: ACT03705
UniProt: C6D177
Position
5847732..5848769
Genome map
AA seq 345 aa AA seqDB search
MKKFGILATVLAVAFTLAACGGKDNKPAAAEANSANSQQAEAANDPIKIKIADTSTNPVF
RVAKSKGFLEKYGIDADIITFATPAEGINSLFIKQADIGWGADFPSLNAVSKGEFSIIAA
TGTDTEAAAAQWKLFVRDEIQSPADLKGKKLSTLRGTFLPYLWDVYLKDNGVAAGDTKEI
GQGGFDEAYVALKKGEIDASWVVGATLIDKFKAIEGVHELTDMSKTSIRIGGTIIAPNSL
IKDHPQAIANFLKALDETSKYIAANPDETADILFAETKQPKEATIRDLATNNWTVGFTQQ
SFDSLTNQKNYMVGAGIIQNDFNLADKLSLDGVQLAVPDQFTYKK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttcggtattctcgcaacggtcctggccgttgccttcacccttgccgcatgc
ggcggcaaggataataagccggcagcggctgaagcgaattcggcaaacagccagcaggcg
gaagctgctaatgatccgattaagattaaaatcgccgacacgtcgaccaacccggtattc
cgcgtagcgaagagcaaaggcttcctcgagaaatacggcattgatgccgacatcattacc
ttcgctactcctgcggagggtattaactccttgttcatcaagcaggcggatatcggctgg
ggcgcggacttcccgtcgctgaacgcggtaagcaaaggcgaattttcgattattgccgcg
acaggcacggataccgaggcagccgctgcccaatggaagctttttgtccgggatgaaatc
cagtcccctgccgatttaaagggtaagaagctaagcacccttcgcggcacattcctccct
tatttgtgggatgtttacttgaaggataacggcgtagcggctggcgatacgaaagagatt
gggcaaggcggcttcgacgaggcttacgttgcgctcaaaaaaggcgaaatcgatgccagc
tgggtcgtaggcgctacgttgatcgataagttcaaagcgattgaaggcgtgcacgagctc
accgatatgtccaaaacatcgattcggatcggcggcacgattatcgcccctaattccttg
ataaaggatcatccgcaggcgattgccaacttcctaaaggcattggatgagacctccaag
tacattgcggctaatccggacgaaacggccgacatcctttttgcggaaaccaagcagccg
aaggaagcaacgatccgggatttggcgacgaacaactggacggttggcttcacccagcaa
tccttcgacagcctgacgaatcagaaaaactatatggtaggagccggtattattcaaaac
gacttcaacctggccgataagctgagcctggacggcgtacagctggccgtacccgatcaa
ttcacctataagaaataa

DBGET integrated database retrieval system