KEGG   Paenibacillus sp. JDR-2: Pjdr2_6163Help
Entry
Pjdr2_6163        CDS       T00977                                 

Definition
(GenBank) malate/quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00020  Citrate cycle (TCA cycle)
pjd00620  Pyruvate metabolism
pjd01100  Metabolic pathways
pjd01110  Biosynthesis of secondary metabolites
pjd01120  Microbial metabolism in diverse environments
pjd01130  Biosynthesis of antibiotics
pjd01200  Carbon metabolism
Module
pjd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pjd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pjdr2_6163
   00620 Pyruvate metabolism
    Pjdr2_6163
Enzymes [BR:pjd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Pjdr2_6163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase HI0933_like FAD_binding_2 Pyr_redox_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACT04766
UniProt: C6D7F5
Position
complement(7054335..7055840)
Genome map
AA seq 501 aa AA seqDB search
MSKQTKTDVILIGAGIMSATLGSLLKELKPEWEITVFERRATAGEESSNEWNNAGTGHSS
LCELNYTTEKPDGSIDISKAVKVNEEFQVSKQFWSYLVNSNLIRNPRDFVVPVPHMSFVQ
GEKDVTFLKKRFAALSGNPLFEGMEFSDDPAKLAEWIPLMMKDRKVNTPIAATRIESGTD
VNFGSLTRILFNQLKQQNVDINYNHNVDDIKRANDGTWELKVRNLQSGSSERINAKFVFI
GGGGGSLHLLQKSGIKEGKGIGGFPVSGLFMVCKKPEVVAQHRAKVYGQAPVGAPPMSVP
HLDTRVIDNKESLFFGPFAGFTPKFLKFGSNMDLITSVKPHNLTNMLAAGAKNMSLTTYL
IKQLMLSKEQRMEALREFIPNAKSEDWELLVAGQRVQIIKETNAGKGTLQFGTEVISAAD
GSIAALLGASPGASTAVSVMLEVIGKCFPQHIKEWEPKIKEMIPSYGTKLLQNPELIQQI
NATTNAALGLAGKKQTSSALA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacaaacgaaaacagacgtaattttgattggtgccggcattatgagtgctact
ttgggttctttgctgaaggaactgaagccagagtgggaaattaccgtattcgagcgccgc
gcaacagccggtgaagaaagctccaacgaatggaacaacgcagggacaggacactcctcc
ctatgcgagctgaactacacgacggagaagccggacggttccatcgacattagcaaagcg
gtcaaagtcaatgaagagttccaggtatcgaagcagttctggtcttatctcgtaaacagc
aatctgatccgtaatccgcgggactttgttgtacccgttcctcatatgagctttgtgcaa
ggggaaaaagacgttacgttcctgaagaagcgttttgcggcattgtccggcaatccattg
tttgaaggcatggaattctccgatgaccctgcgaagctggcagaatggattccgcttatg
atgaaagaccgcaaagtaaatacgccaattgctgcaaccagaattgagtccgggacggat
gtcaactttggttctttaacacgtattctgttcaatcaattgaagcagcaaaacgtggac
ataaactataaccataatgtagatgatattaaacgtgcaaacgacggcacttgggaactg
aaagtgcgcaatctgcaaagcggcagctcggaacgcatcaatgcgaagttcgtctttatc
ggcggcggcggcggaagcctgcacctgctgcaaaaatccggcattaaggaaggcaaaggc
atcggcggcttcccggtaagcggtctgttcatggtctgcaagaagccggaagtggtggct
cagcaccgtgcgaaggtatacggccaagcgccggttggcgctccgccaatgtccgtgccg
catctggatacgcgcgttatcgacaacaaagagtcgttgttcttcggtccgtttgcgggc
tttacgccaaagttcctgaaattcggttccaacatggacctgattacatccgtcaaaccg
cataacttaacgaacatgctcgcggcaggcgcgaaaaatatgtccctgaccacgtacctg
atcaaacagctgatgctgtccaaagaacagcgcatggaagccttgcgcgagttcatcccg
aatgcaaagagcgaagattgggagctgctcgtggctggccaacgcgtacagattattaaa
gaaacaaatgcaggcaaaggcactctgcaattcggtacggaggttattagcgcggctgac
ggctcgatcgctgcccttcttggcgcttcgccgggcgcatcgacagccgtttcggttatg
ctcgaagtaatcggcaaatgcttcccgcagcatatcaaagagtgggagcctaagatcaag
gaaatgattccgtcctacggaacgaagcttctgcaaaaccctgagctgatccagcagatc
aatgcaacaacgaatgcggctcttggactcgcaggcaaaaaacaaacgagctcggcgttg
gcataa

DBGET integrated database retrieval system