KEGG   Paenibacillus kribbensis: B4V02_09915Help
Entry
B4V02_09915       CDS       T05249                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pkb  Paenibacillus kribbensis
Pathway
pkb00450  Selenocompound metabolism
pkb00970  Aminoacyl-tRNA biosynthesis
pkb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pkb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    B4V02_09915
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B4V02_09915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pkb01007]
    B4V02_09915
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pkb03016]
    B4V02_09915
Enzymes [BR:pkb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     B4V02_09915
Amino acid related enzymes [BR:pkb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   B4V02_09915
Transfer RNA biogenesis [BR:pkb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    B4V02_09915
 Prokaryotic type
   Other AARSs
    B4V02_09915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ASR46972
UniProt: A0A222WLT4
Position
2212562..2214580
Genome map
AA seq 672 aa AA seqDB search
MSHENTFYITTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYEVRYLTGTDEHGQKIEQ
KASAAGKTPQRFVDDIVAGIQDLWRKLDISNDDFIRTTEERHKTVVQDIFDRLLKQGDIY
KGEYEGWYSIPDETYYTETQLVDVVKDAEGNVAGGKSPDSGHPVELVKEECYFFRMSKYA
DRLLQFYEENPQFIQPESRKKEMINNFIKPGLEDLAVSRTTFDWGIKVKGDPKHVVYVWI
DALSNYITALGYGSSNTELYDKFWPANVHIVGKEIVRFHTIYWPIMLMALDLPLPKKVFA
HGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDQLRYYLLREVPFGADGTFTPESFVDRVNS
DLANDLGNLLNRTVAMVDKYFAGKVPAYEANVTAFDGALVEMATSTYSKVEEAMENMEFS
VALTAISQFISRSNKYIDETQPWNLAKDENNRRELASVMVHLVESLRIASILLQPFLTRA
PHKIWEQLGISQGELTTWDSGKQFGRIPEGTQLVKGNPIFPRLDSEQEVAFIVEAMTGGK
KPEEAAAQVQPQNAAEAGQEAPEAKEEIGIEDFAKVELRVAQVIACELVKKADKLLKLQL
DLGYEQRQVVSGIAKFYTPEDMIGRKVICVTNLKPVKLRGELSQGMILAASHGDQLTLAT
VPDGMPNGAIVK
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatgagaacacattttacattacgacaccgatctattatcccagtgacaagctt
catataggtcatgcttatacgacggtagcgggtgatgcgatggctcggtacaagcggctg
cgaggctatgaggttcgttatttgacaggaacggatgagcatggtcagaaaattgagcag
aaggcgagtgcagccggtaaaacgccgcagcgtttcgttgatgatatcgtggcaggtatt
caagatctgtggcggaagctcgacatttccaatgacgattttatccgtaccacagaagaa
cgtcacaagacagtcgtacaggacatttttgatcgtttgctgaagcaaggcgatatttac
aagggagaatacgaaggctggtacagcattcctgacgagacttactacaccgaaactcaa
ctggttgatgtggtgaaggacgctgaaggcaatgtagctggaggtaaaagtccggatagt
ggacacccggtagaactagtcaaggaagaatgctattttttccgtatgagcaagtatgct
gatcggttgctgcaattttatgaggagaacccgcagtttatccagccggaatcccgcaaa
aaagagatgattaataacttcatcaagccggggctggaggatctggcagtatcccgcaca
acctttgactggggcattaaagtgaagggtgatccgaagcatgtcgtatacgtatggatt
gacgcgctttccaattatattacagccttgggttatggttcctccaatactgagctgtat
gataaattttggcctgcaaatgtgcacatcgtaggtaaagagattgtgcgcttccacacg
atctattggccgattatgctgatggcgctggatcttccgttgcccaaaaaggtatttgca
catggctggctgcttatgaaagacggtaaaatgtcgaagtccaaaggcaatgtcgtagac
ccggttacgttgattgaccgttatggtctggatcagcttcgctactacctgctgcgcgag
gtgcctttcggggcggatggaaccttcacaccagaaagctttgtggatcgggtgaattcg
gatctggccaatgatttgggtaatttgttgaaccgtaccgtagcgatggtagacaaatat
tttgcaggcaaggttccagcttatgaagcgaatgtaacagcattcgacggagctttggta
gagatggcaacatcgacttacagtaaagtagaagaagcgatggaaaacatggagttttcc
gtggcattgacagcgattagccaatttattagccgcagcaacaagtatattgacgagacg
caaccatggaatttggctaaggatgagaacaatcgccgcgaattggcatccgtcatggtg
catttggtagaaagcttgcgtatcgcttccattctgctgcaaccgttcttgacgcgtgct
cctcataaaatttgggaacaactcggtatcagccaaggtgagctaactacatgggatagc
ggcaagcagtttggacgtattccagaaggaacgcagctggtcaaaggcaatccaattttc
ccgcgtctggactcggagcaggaggttgctttcattgtggaagccatgacgggaggcaag
aagccggaggaagctgcggctcaagttcagccacaaaatgcagctgaggcaggccaggag
gcaccagaggcgaaggaagagattggcattgaggattttgccaaggtagaactgcgagtc
gctcaggtcattgcctgtgagcttgtgaagaaggctgacaaactgttgaagcttcaactt
gatctcggttatgagcagcgccaggttgtatcgggaattgccaagttttatacgccagag
gatatgattggacgcaaggtgatttgtgtgaccaaccttaagcctgtgaaacttcgtgga
gagctgtcacaaggtatgattttggcagcatcgcatggagatcagctcacgctggccacc
gtaccggatggtatgccgaatggtgcgattgtaaagtag

DBGET integrated database retrieval system