KEGG   Paenibacillus kribbensis: B4V02_10275Help
Entry
B4V02_10275       CDS       T05249                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
pkb  Paenibacillus kribbensis
Pathway
pkb00740  Riboflavin metabolism
pkb00790  Folate biosynthesis
pkb01100  Metabolic pathways
pkb01110  Biosynthesis of secondary metabolites
Module
pkb_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pkb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    B4V02_10275
   00790 Folate biosynthesis
    B4V02_10275
Enzymes [BR:pkb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     B4V02_10275
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     B4V02_10275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase YiiD_C
Motif
Other DBs
NCBI-ProteinID: ASR47041
UniProt: A0A222WMS3
Position
2282018..2282701
Genome map
AA seq 227 aa AA seqDB search
MDRGSQTSAAADVMEHDEGELDEEIRLDSIEEALEDLKNGKVVIVVDDEQRENEGDFVAL
AEKATPEVINFMITEGRGLVCVPITQQRAEALELQPMVEQNTDFHGTAFTVSVDHMETIT
GISAAERSLTVRALADDTVVGGDFRKPGHMFPLIARDGGVLQRAGHTEAAVDLARLSGFK
PAGVICEIIKEDGTMARLPDLAVFAKHHQLKLISIQDLIDYRRRLSL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggatcgagggagtcaaacaagtgcagcggctgacgtaatggagcatgacgagggggaa
ctggacgaagagattcgtctggattccatcgaagaagcgctggaggatttgaagaacggt
aaagtcgttatcgtcgtggatgatgaacagcgcgaaaatgaaggtgattttgttgcgttg
gctgaaaaggcaactccggaggtcattaatttcatgatcactgaaggtcgtggattggtt
tgtgtgccgataacacaacaaagagccgaggcattggagctgcagccaatggtggagcag
aatacagatttccacggcacagcctttaccgtgtcggttgatcatatggagacaataaca
ggtatttcggcagccgagcgttccttgactgtacgcgccttggctgacgatacagtcgta
ggaggcgattttcgcaagcctggccacatgtttccgctgattgcccgcgatggcggtgtt
ttgcagcgtgcaggtcatacggaagcggcagtcgatctggcccgactcagcggcttcaag
cccgccggagtcatttgcgaaattataaaggaagacggcaccatggcccgactgcctgat
ttggccgtgttcgccaagcatcatcagctgaagctgatcagtattcaggatttaattgac
tatcgtcgtcgtttgtcattgtaa

DBGET integrated database retrieval system