KEGG   Paenibacillus kribbensis: B4V02_17660Help
Entry
B4V02_17660       CDS       T05249                                 

Definition
(GenBank) RNA pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
pkb  Paenibacillus kribbensis
Brite
KEGG Orthology (KO) [BR:pkb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pkb03009]
    B4V02_17660
Enzymes [BR:pkb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     B4V02_17660
Ribosome biogenesis [BR:pkb03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    B4V02_17660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 Ub-Mut7C CooT
Motif
Other DBs
NCBI-ProteinID: ASR48395
UniProt: A0A222WQX9
Position
complement(3962252..3963208)
Genome map
AA seq 318 aa AA seqDB search
MDLYYEPIVYMIPPEEEGMLLKTILQKRMNISRKLISKLKLTEQGIMLNGTRVYISVKVK
AGDRVEIRMERERSDDILPEPIPFDILYEDEHLLVVNKAAGIIVHPTHGHYTGTLANGVV
HYWQSKGELFRFRPVHRLDQETTGVLVVAKNPYVHQHISEQMIAGTVDKRYTALVHGCPG
QPEGQVDGPIDRNPDDPHMRMVTPSGYPALTMYKLEEAWNEGSRMGLKLESGRTHQIRVH
MTYIGCPLIGDKMYRAIPDDAARREQYEQLDAQMPRQALHASELSLVHPVTGERLTFCAP
LPDDMAEMQELLRNKMED
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggacttgtactatgaacctatcgtatatatgatccctcctgaggaggagggcatgctg
ttgaagacgattttacagaaaagaatgaacatttcacggaagctgatatccaaactcaag
ctaacagagcaagggatcatgctgaacgggacacgagtgtacatcagcgtaaaggtaaag
gctggggatcgggtggaaatccgcatggagcgcgagcgttccgatgatattttacctgaa
ccgattccttttgacattttgtatgaggatgagcacctgttggtcgtaaacaaggcggcg
ggaatcattgttcatccgacacatggacattacacaggcactctggctaacggagttgtg
cattattggcagtccaaaggagagctgttccggttccgtcctgttcatcgtctcgatcag
gagacgacaggtgtgctcgttgtggctaaaaatccgtatgtgcaccagcatatttccgag
cagatgattgcgggaacggtggataagcgctacacagctctggtgcacgggtgtcctggg
caaccggaaggacaggtggatggaccgattgatcgcaatccggatgatccgcatatgaga
atggtgactccgagtggttatcctgctctgacgatgtacaagctggaggaagcctggaac
gaagggagccgaatgggtctaaaactggaatccgggcgtacacaccagattcgtgtgcat
atgacgtacatcgggtgcccgttgatcggagacaaaatgtaccgggcgatacccgatgac
gcagcgcgtcgtgagcaatatgagcagcttgatgcccagatgcctcggcaagcgctgcat
gcctcggaactgtccttggtgcaccctgtgacaggggagcgactgacgttctgtgctcct
ctaccggatgatatggccgaaatgcaggagctgttaagaaacaaaatggaggattaa

DBGET integrated database retrieval system