KEGG   Paenibacillus kribbensis: B4V02_19895Help
Entry
B4V02_19895       CDS       T05249                                 

Definition
(GenBank) cellobiohydrolase
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
pkb  Paenibacillus kribbensis
Pathway
pkb00500  Starch and sucrose metabolism
pkb01100  Metabolic pathways
pkb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pkb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B4V02_19895
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B4V02_19895
Enzymes [BR:pkb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     B4V02_19895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6 CBM_3 fn3 Pea-VEAacid LTD
Motif
Other DBs
NCBI-ProteinID: ASR48796
UniProt: A0A222WRJ9
Position
complement(4453091..4455334)
Genome map
AA seq 747 aa AA seqDB search
MKQLKTKQVLRKGMKYAFALSLVAGSFLPGTGLTGKINAESHVDNPYIGATKYISPDYAA
FVDSSIAKVTDANLKAKMQTVKTFPTSVWLDRIAAIKGTPGNLGLEEHLDQVLAQKKGDT
PITAEFIIYDLPGRDCHALASNGELPLTQAGLETYKKDYVDKIAEILANPKYKDIRIVTI
IEPDSLPNLVTNMSDPKCAQAKSTGIYETGIQYTINKLNEIPNVYKYVDIGHSGWLGWDN
NRSATVSLYTNVFRNTSKGLSSVDGFITNTANTTPLVEPNLPDSNLNINGQPIKSSKYYE
WNPYFDELHFTEGLHRDFVNAGWPSSLGMLIDTGRNGWGGPNRPTKATGNDINSYVNSGR
VDRRDHRGNWCNNSGAGMGTPPQTAPASHVDAYVWAKPPGASDGSSSLIPNDEGKGFDRM
CDPTYTTSDGVLTGALPNAPISGAWFHDQFVMLVNNAYPAIKAADGSVEPTPTPTPTPTP
EAPAVPADLQGKLGVKLTWAASTGAQSYTVKRATSEEGPFTTIASRVTGTEYTDTDLTNG
TTYYYVISATNANGSSKDSAVVKVTVGSKATTPTDPTPTPTPTPTDPTDPTDPTPTPTPT
PTEPAGDLAVLYRAGDTDPTNNAIKPFFNVKNNGTTPVKLSDLKIRYYFTKEGSQEMQSA
VDWAQIGNDNVLRTFTDKYIEIGFSPAAGTLAAGAQTGEIQVRINKSDWSNHDESNDYSF
DPTKSSYTEWNKVTLYQNDKLVWGIEP
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaattgaaaacaaagcaagtgcttcgtaaaggcatgaagtatgcttttgcgtta
tcactcgtcgcaggtagttttttaccaggtacaggattgacaggtaaaataaatgcagaa
tcccatgtggacaacccttatatcggggcaacaaaatatattagtcctgattacgccgct
ttcgtcgattcgtcaattgccaaggttaccgatgctaatctgaaagcgaaaatgcaaacc
gtcaaaacgttcccgacatccgtatggctcgatcgcatcgctgccattaaaggaactcca
ggcaatcttggtctggaagagcatctggatcaagtattggcccaaaagaaaggcgacacg
ccgattacggcagagtttattatatatgatctgcccggacgggattgtcatgccttggct
tccaacggtgagcttccgctgacccaggcaggtctggaaacgtacaaaaaggattatgtc
gacaagattgctgagatccttgccaaccccaaatataaggacattcgtatcgtaacgatc
attgaaccggacagtttaccgaacctggtaaccaatatgagcgatccaaaatgtgctcaa
gccaaatccaccggtatctatgaaaccggcattcagtacacaatcaacaaactgaacgaa
attcctaacgtatacaaatacgtagatatcggtcactccggctggctcggttgggataac
aaccgttcagcaacagtttctctgtataccaacgttttcagaaacacatctaaaggattg
tccagcgtagacggctttatcaccaatacagccaacactacgccgctggttgagcctaat
ctgcctgattccaacctgaatattaacggacagccgatcaagtcttccaagtattacgaa
tggaacccttacttcgatgagctgcatttcacagaaggtctgcacagagattttgtaaat
gcaggctggccaagttctctcggtatgctgattgataccggccgtaacggctggggtgga
ccgaaccgtccaactaaagctacaggtaacgatatcaattcgtacgtgaactcaggccgt
gtggacagacgcgaccatcgcggtaactggtgtaacaacagtggcgcaggtatggggaca
cctcctcaaaccgctccagcttcccatgtcgatgcatatgtatgggcgaagcctccgggt
gcttccgacggctccagctcgctcattccgaacgatgagggcaaaggctttgaccggatg
tgtgatcctacttacacaaccagtgacggcgtattgacaggcgcattgccaaatgctccg
atttccggtgcgtggttccatgatcagttcgttatgctcgtgaacaatgcatatccagca
atcaaagctgccgatggtagcgtagaaccaactccaacacctacacctacaccaacacca
gaagctccggcagtaccggcagacttacagggaaaattgggtgtgaagctgacttgggct
gcttccactggtgcccaaagctacacagtgaagcgtgctaccagtgaggaaggtcctttt
acaacgattgcgtctcgtgtaacaggcacagaatacacggatacagatttgacgaatgga
acgacttactactatgtaataagtgctacgaatgcaaatggttcaagcaaggattcggct
gtagtgaaagtgactgttggatcgaaggctactacaccaacagatccaactccaacacct
acaccaactccaacagatccaactgacccaacagatccaacacctacaccaactccgact
ccaacagaacctgcaggtgatctggctgttctgtaccgggctggagataccgatccaacg
aataatgcaattaaaccattttttaacgtaaaaaataacgggacaactcctgtaaagctg
agtgacctgaaaatccgctactatttcactaaagagggtagccaggaaatgcagtctgca
gtggactgggcacaaataggtaatgataacgtgctgcgtacctttacagacaaatatatt
gaaattggtttcagtcctgctgccggcacgcttgctgctggagcacaaacaggtgaaatt
caggtccgcattaacaaaagcgactggtctaaccacgacgaatccaatgactactcgttc
gatccaaccaaaagctcttatacagaatggaacaaagtaacattgtaccaaaatgataag
ctggtatggggaatcgagccttaa

DBGET integrated database retrieval system