KEGG   Paenibacillus kribbensis: B4V02_21910Help
Entry
B4V02_21910       CDS       T05249                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
pkb  Paenibacillus kribbensis
Pathway
pkb00511  Other glycan degradation
pkb00600  Sphingolipid metabolism
pkb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pkb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    B4V02_21910
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    B4V02_21910
Enzymes [BR:pkb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     B4V02_21910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C
Motif
Other DBs
NCBI-ProteinID: ASR49164
UniProt: A0A222WTE7
Position
4916160..4917503
Genome map
AA seq 447 aa AA seqDB search
MSNQTIQWFSTSKTQAWQSQAHNLTQTQEQANLTITEEVYQLVEGFGGCFNELGYVALNH
LESAEREQVLHSLFHPEGEHKFTICRLPIGASDYALEWYSHNETDGDVEMKHFSIERDQQ
YLIPYIREALKLNPGLKLFASPWSPPTWMKSPKAYNYGTLRWEKDILKAYALYFVKFVQA
YREEGITIHQIHVQNEVIADQKFPSCVWTGEQLREFIRDYLGPAFEEHGLDTEIWLGTIN
APDPWEELTKKISTGFDEYAHTVLSDPEAYKYIKGVGYQWAGKNAIQRTVASYPELRYMQ
TENECGNGENSWDYAKYVYNLYQHYFTNGVNAYIYWNMVLEPKGKSTWGWEQNSMITVDP
ADRKPVLNPEYYVMKHFSHFVLPGARRIGLRGSWTGNAVAFQNADGQRVLVIANPFHESR
ALNLSVGQTTHHLELEPESFNTIVIPS
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcaaaccattcagtggttttccacttccaagacccaggcttggcaatcccaa
gctcataatctcacccaaacgcaagagcaggcaaacctgaccatcacggaagaagtgtat
cagcttgtcgaaggctttggcggctgttttaatgaactggggtatgtggccctgaaccac
ctggaaagcgccgaacgtgagcaggtgctgcattccctctttcacccggagggcgagcac
aaattcacgatttgtaggctgcccattggcgccagtgactacgcgctggagtggtacagt
cacaatgaaacagacggcgacgtggaaatgaagcacttttccattgaacgcgatcagcaa
tatcttattccttacattagagaagcactgaaactcaatccgggcttgaagctgttcgct
tccccctggagcccgccgacatggatgaaatcacccaaggcctacaattacggcacgctg
cgctgggaaaaggatattttgaaagcgtatgcattatattttgtcaaatttgtgcaagca
taccgtgaagaaggaattacaatccatcagattcatgtccaaaatgaagtcattgccgat
caaaagttcccttcctgtgtgtggacgggagaacagctgcgtgaatttattcgcgactat
ttgggccctgcttttgaggaacacggactggatacggaaatatggctcggtaccattaat
gctcccgatccgtgggaggagttaacaaaaaagatttccaccggattcgacgagtatgcc
cataccgtgctgagtgacccggaagcctacaaatatattaaaggcgtgggctatcaatgg
gcaggcaaaaatgcgattcaacgcaccgtggccagttatcccgagcttcgttacatgcag
accgaaaatgaatgcgggaacggggaaaactcatgggactacgctaaatatgtatacaac
ttgtaccagcattatttcacgaacggtgtgaatgcttatatttactggaatatggttttg
gagccgaaaggcaagagcacatggggctgggagcaaaattcgatgattactgtcgatcca
gcagatcgaaagcctgtcctgaacccggaatattacgttatgaagcatttttctcatttt
gtattaccgggagccagacgcattggacttcgcggttcatggactggaaatgccgttgcc
ttccaaaatgcggacggacaaagggtgctggtcatcgccaatccgttccacgaatcgcgc
gcgctgaatctgtctgtgggacaaacaacgcaccatttggaactggagccggagtcattt
aacaccatcgttattccttcttaa

DBGET integrated database retrieval system