KEGG   Pseudomonas knackmussii: PKB_0169Help
Entry
PKB_0169          CDS       T03081                                 

Gene name
cfiB
Definition
(GenBank) 2-oxoglutarate carboxylase small subunit
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
pkc  Pseudomonas knackmussii
Pathway
pkc00020  Citrate cycle (TCA cycle)
pkc00620  Pyruvate metabolism
pkc01100  Metabolic pathways
pkc01120  Microbial metabolism in diverse environments
pkc01200  Carbon metabolism
pkc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pkc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PKB_0169 (cfiB)
   00620 Pyruvate metabolism
    PKB_0169 (cfiB)
Enzymes [BR:pkc01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     PKB_0169 (cfiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK ATP-grasp_4 ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: CDF81548
UniProt: A0A024HAM6
Position
180368..181783
Genome map
AA seq 471 aa AA seqDB search
MIKKILIANRGEIAVRIVRACAEMGIRSVAIYSEADRHALHVKRADEAHSIGEDPLAGYL
NPRALVNLAVETGCDALHPGYGFLSENAELAEICAERGIKFIGPSAEVIRRMGDKTEARR
SMMAAGVPCTPGTEGNVADLAEALREAERIGYPVMLKATSGGGGRGIRRCNSRDELEQAF
PRVISEATKAFGSAEVFLEKCIVNPKHIEAQILADSFGNTVHLFERDCSIQRRNQKLIEI
APSPQLTPEQRAYIGDLAVRAAKAVGYENAGTVEFLLADGEVYFMEMNTRVQVEHTITEE
ITGIDIVREQIRIASGLELSVKQEDIIHRGFALQFRINAEDPKNNFLPSFGKITRYYAPG
GPGVRTDTAIYTGYTIPPYYDSMCLKLIVWALTWEEALDRGLRALDDMRVQGVRTTAPYY
QEILRNPEFRSGQFNTSFVESHPELTQYSIKRNPSHLAIAIATAIAAHAGL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaagaaaatcctgatcgccaaccggggagagatcgctgtccgcatcgtgcgtgct
tgcgccgagatgggcatccgttcggtggccatctactccgaagccgaccgtcacgccttg
cacgtgaagcgcgccgacgaagcccacagcatcggcgaggacccgctggccggttacctg
aacccgcgtgccctggtgaacctggcggtggaaaccggctgtgacgcccttcacccgggc
tacggtttcctctcggagaacgccgagcttgcggaaatctgcgccgagcgcgggatcaag
ttcatcggcccgtccgccgaagtgatccgccgcatgggcgacaagaccgaagcccgccgc
agcatgatggctgccggcgtgccttgtaccccgggcaccgaaggcaacgtcgccgacctc
gccgaagccctgcgcgaagccgagcgcattggctacccggtgatgctcaaggccacttcc
ggcggtggcggccgcggcatccgccgctgcaacagccgcgacgaactggaacaggctttc
ccccgcgtgatctccgaagccaccaaggccttcggcagcgcagaggtgttcctcgagaag
tgcatcgtcaatccgaagcacatcgaagcgcagatcctcgccgactccttcggcaacacc
gtgcacctgttcgaacgcgactgctcgatccagcgccgcaaccagaagctcatcgagatc
gccccgagcccgcagctcacccccgagcagcgcgcctacatcggtgacctcgccgtgcgc
gcggccaaggccgtgggctacgagaacgccggtaccgtggagttcctgctcgccgatggc
gaggtgtacttcatggagatgaacactcgcgtgcaggtggagcacaccatcaccgaggaa
atcaccggcatcgacatcgtccgcgagcagattcgcatcgcttccgggctggaattgtcg
gtgaagcaggaagacatcatccaccgcggcttcgccctgcagttccggatcaacgccgag
gacccgaagaacaacttcctgccctcgttcggcaagatcacccgctactacgcgcccggc
ggccccggcgtgcgtaccgacacggcgatctacaccggctacaccattccgccctattac
gactccatgtgcctgaagctgatcgtctgggcactgacctgggaggaggcgctcgatcgc
ggcctgcgcgcgctggacgacatgcgcgtacagggtgtgcggaccaccgcgccgtactac
caggaaatcctgcgcaacccggaattccgctccggccagttcaacaccagcttcgtcgag
agccatccggaactgacccagtactcgatcaagcgcaacccgtcgcacctggccatcgcc
atcgccactgccatcgccgcccacgccggcctgtag

DBGET integrated database retrieval system