KEGG   Pseudomonas knackmussii: PKB_1234Help
Entry
PKB_1234          CDS       T03081                                 

Gene name
accA
Definition
(GenBank) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
pkc  Pseudomonas knackmussii
Pathway
pkc00061  Fatty acid biosynthesis
pkc00620  Pyruvate metabolism
pkc00640  Propanoate metabolism
pkc01100  Metabolic pathways
pkc01110  Biosynthesis of secondary metabolites
pkc01120  Microbial metabolism in diverse environments
pkc01130  Biosynthesis of antibiotics
pkc01200  Carbon metabolism
pkc01212  Fatty acid metabolism
Module
pkc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pkc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PKB_1234 (accA)
   00640 Propanoate metabolism
    PKB_1234 (accA)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PKB_1234 (accA)
Enzymes [BR:pkc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     PKB_1234 (accA)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PKB_1234 (accA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans MdcE ECH_1 baeRF_family3
Motif
Other DBs
NCBI-ProteinID: CDF82599
UniProt: A0A024HDF7
Position
1299471..1300421
Genome map
AA seq 316 aa AA seqDB search
MNPNFLDFEQPIADMQAKIEELRLVGNDNSINISDEISRLEDKSRALTENIFGNLSSWQI
AQLARHPRRPYTLDYIEHIFTEFEELHGDRHFADDAAIVGGVARLGEQPVMVIGHQKGRE
VREKVRRNFGMPRPEGYRKACRLMEMAERFKMPILTFIDTPGAYPGIDAEERGQSEAIAW
NLRVMARLKTPIIATVIGEGGSGGALAIGVCDNLNMLQYSTYAVISPEGCASILWRTAEK
APEAAEAMGITAARLKDLGIVDTVIPEPLGSAHRDPAAAAQNIRTAIESQLAMLKGLSID
KLLERRYERLMSYGIA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgaatttcctcgatttcgaacagccgatcgccgacatgcaagccaagatcgaa
gagcttcggctggtcggcaacgacaactcgatcaacatcagcgacgagatctcccgcctg
gaagacaagagccgggcgctgaccgagaacatcttcggcaacctgagcagctggcagatc
gcccagctcgcccgccatccgcgccgcccctacaccctcgactacatcgagcacatcttc
accgagttcgaagagctgcacggcgaccgtcacttcgccgatgatgccgcgatcgtcggc
ggcgtggctcgcctgggcgagcagccggtgatggtcatcggccatcagaaaggccgcgaa
gtgcgcgagaaagtgcgccgcaacttcggcatgccgcgtccggaaggctaccgcaaggct
tgccgcctgatggaaatggccgaacgcttcaagatgccgatcctgaccttcatcgacacc
cccggcgcctacccgggtatcgacgccgaagaacgcggccagagcgaggccatcgcctgg
aacctgcgcgtcatggcgcgcctgaagaccccgatcatcgccaccgtcatcggtgagggt
ggttccggcggtgcgctggccatcggtgtctgcgacaacctgaacatgctgcagtactcc
acctacgcggtgatctcgccggaaggctgtgcctcgatcctctggcgtaccgcagagaag
gcgcctgaagccgcagaggccatgggcatcaccgcggcgcgcctgaaggacctgggtatc
gtcgacaccgtgatcccggagccactgggcagcgcccaccgcgatccggctgccgccgcg
cagaacatccgtaccgccatcgagtcgcaactggccatgctcaagggcctgagcatcgac
aagctgctggagcgccgctacgagcgcctgatgagctacggcatcgcctga

KEGG   Pseudomonas knackmussii: PKB_3865Help
Entry
PKB_3865          CDS       T03081                                 

Gene name
accD
Definition
(GenBank) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
pkc  Pseudomonas knackmussii
Pathway
pkc00061  Fatty acid biosynthesis
pkc00620  Pyruvate metabolism
pkc00640  Propanoate metabolism
pkc01100  Metabolic pathways
pkc01110  Biosynthesis of secondary metabolites
pkc01120  Microbial metabolism in diverse environments
pkc01130  Biosynthesis of antibiotics
pkc01200  Carbon metabolism
pkc01212  Fatty acid metabolism
Module
pkc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pkc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PKB_3865 (accD)
   00640 Propanoate metabolism
    PKB_3865 (accD)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PKB_3865 (accD)
Enzymes [BR:pkc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     PKB_3865 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PKB_3865 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans zf-ACC DUF3688 Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID: CDF85199
UniProt: A0A024HKN3
Position
complement(4056570..4057445)
Genome map
AA seq 291 aa AA seqDB search
MSNWLVDKLIPSIMRSEAKKSSVPEGLWHKCPSCDAVLYRPELEKTLDVCPKCDHHMRIG
ARTRLDIFLDAEGREELGADLEPVDRLKFRDTKKYKDRLVSAQKDTGEKDALISMSGKLQ
GMPVVACAFEFSFMGGSMGSIVGERFVRAANVALEKRCPMICFSASGGARMQEALISLMQ
MAKTSAALARLREEGIPFISVLTDPVYGGVSASLAMLGDVIVGEPKALVGFAGPRVIEQT
VREKLPEGFQRSEFLLAHGAIDMIVHRSEMRSRLASLLAKFTNTPSAALAG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactggttggtagacaagctgatcccctccatcatgcgttccgaggctaagaag
agctcggttccggaaggcctgtggcacaagtgcccgtcctgcgacgcggtgctgtatcgc
ccggagctggagaagaccctggacgtctgccccaagtgcgaccaccacatgcgtatcggt
gcgcgcacccggctggacatcttcctcgatgccgaaggccgcgaagagctcggcgccgac
ctcgagccggtggatcgcctgaagttccgtgacaccaagaagtacaaggatcgcctggtc
tccgcgcagaaggacaccggcgagaaagacgcgctgatctccatgagcggcaagctgcag
ggtatgcctgtcgtggcgtgcgccttcgagttctccttcatggggggctccatgggttcc
atcgttggcgagcgcttcgtacgtgcggccaacgtcgccctggaaaagcgttgcccgatg
atctgcttctccgcctcgggcggtgcgcgcatgcaggaagcgctgatctcgctgatgcag
atggccaagacttccgcggcgctggcacgtctgcgcgaggaaggcattcccttcatctcc
gtgctgaccgacccggtttacggtggtgtttctgccagcctggcgatgctgggtgacgtc
atcgtcggcgagcccaaggcgctggtcggcttcgccggtccgcgcgtgatcgagcagacc
gtgcgcgagaagctgccggaaggcttccagcgcagcgagttcctgctggcccacggtgcc
atcgacatgatcgtgcaccgctcggaaatgcgttcgcgcctggccagtctgctggccaag
ttcaccaacacccccagcgccgccctcgcaggatga

KEGG   Pseudomonas knackmussii: PKB_5166Help
Entry
PKB_5166          CDS       T03081                                 

Gene name
accB
Definition
(GenBank) Biotin carboxyl carrier protein of acetyl-CoA carboxylase
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
pkc  Pseudomonas knackmussii
Pathway
pkc00061  Fatty acid biosynthesis
pkc00620  Pyruvate metabolism
pkc00640  Propanoate metabolism
pkc01100  Metabolic pathways
pkc01110  Biosynthesis of secondary metabolites
pkc01120  Microbial metabolism in diverse environments
pkc01130  Biosynthesis of antibiotics
pkc01200  Carbon metabolism
pkc01212  Fatty acid metabolism
Module
pkc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pkc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PKB_5166 (accB)
   00640 Propanoate metabolism
    PKB_5166 (accB)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PKB_5166 (accB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 YqfD HlyD_3
Motif
Other DBs
NCBI-ProteinID: CDF86479
UniProt: A0A024HPB3
Position
5424109..5424576
Genome map
AA seq 155 aa AA seqDB search
MDIRKVKKLIELLEESGIDELEIKEGEESVRISRHSKTAAQPIYAAAPAYAAPAAAPAPV
AAAAAPAAEAAPAAAKLNGNVVRSPMVGTFYRSPSPTAAPFVEVGQSVKKGDILCIVEAM
KMMNHIEAETSGTIGEVLVESGQPVEYDQPLFTIV
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggacatccgtaaagtcaaaaaactgatcgaactgctcgaagaatccggtatcgacgag
ctggaaatcaaagaaggcgaagagtcggtacgcatcagccgccacagcaagaccgccgct
cagccgatctacgccgccgccccggcctacgccgctccggccgctgctccggccccggtt
gccgccgctgccgccccggccgctgaagctgctccggcagccgccaagctgaacggcaac
gtggtccgttcgccgatggtcggcaccttctaccgttcgccgtcgccgaccgccgctccc
ttcgtggaagtcggccagagcgtgaagaaaggcgacatcctgtgcatcgtcgaagccatg
aagatgatgaaccacatcgaggcggaaaccagcggcaccatcggcgaagtcctggtcgaa
agcggccagccggtcgagtacgaccagccgctgttcaccatcgtctaa

KEGG   Pseudomonas knackmussii: PKB_5167Help
Entry
PKB_5167          CDS       T03081                                 

Gene name
accC
Definition
(GenBank) Biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
pkc  Pseudomonas knackmussii
Pathway
pkc00061  Fatty acid biosynthesis
pkc00620  Pyruvate metabolism
pkc00640  Propanoate metabolism
pkc01100  Metabolic pathways
pkc01110  Biosynthesis of secondary metabolites
pkc01120  Microbial metabolism in diverse environments
pkc01130  Biosynthesis of antibiotics
pkc01200  Carbon metabolism
pkc01212  Fatty acid metabolism
Module
pkc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pkc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PKB_5167 (accC)
   00640 Propanoate metabolism
    PKB_5167 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PKB_5167 (accC)
Enzymes [BR:pkc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PKB_5167 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PKB_5167 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 GARS_A LAL_C2
Motif
Other DBs
NCBI-ProteinID: CDF86480
UniProt: A0A024HN50
Position
5424595..5425944
Genome map
AA seq 449 aa AA seqDB search
MLEKVLIANRGEIALRILRACKELGIKTVAVHSTADRELMHLSLADEAVCIGPAPAGQSY
LHIPAIIAAAEVTGANGIHPGYGFLAENADFAEQVERSGFTFIGPNADVIRLMGDKVSAK
DAMKKAGVPTVPGSDGPLPEDEETALAIAREVGYPVIIKAAGGGGGRGMRVVHSEEDLIK
SAKLTRTEAGAAFGNSMVYLEKFLTNPRHVEVQVLSDGQGNAIHLGDRDCSLQRRHQKVL
EEAPAPGIDEKARQEVLERCVRACIEIGYRGAGTFEFLYENGRFYFIEMNTRVQVEHPVS
EMVTGIDIVKEMLSIASGNKLSFKQEDVVIRGHALECRINAEDPKTFLPSPGKVKHFHAP
GGNGVRVDSHLYSGYAVPPNYDSLVGKIIAYGKDRDEALARMRNALDELIVDGIKTNTEL
HKELVRDKEFCKGGVNIHYLEKKLGMDKH
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaaaagtactgatcgccaaccgcggcgaaatcgccctgcggatcctgcgcgcc
tgcaaggaactgggcatcaagacggtcgcggtgcactccaccgccgaccgtgagctgatg
cacctgtcgctggccgacgaagccgtctgcatcggcccggccccggccggccagtcgtac
ctgcacatcccggcaatcatcgccgccgccgaagtcaccggcgccaacggcattcacccg
ggctacggcttcctcgccgagaacgccgacttcgccgagcaagtggagcgttccggcttc
accttcatcggcccgaacgccgacgtgatccgcctgatgggcgacaaggtctcggccaag
gacgccatgaagaaagccggcgtcccgaccgtaccgggctccgacggcccgctgcccgaa
gacgaggagaccgccctggcgatcgcccgcgaggtcggctacccggtgatcatcaaggcc
gccggtggcggtggtggtcgcggcatgcgcgtggtgcacagcgaggaagacctgatcaag
tcggccaagctgacccgcaccgaagcgggcgctgccttcggcaactccatggtctatctg
gagaagttcctgaccaacccgcgtcacgtggaagttcaggtcctctccgacggccaaggc
aatgccatccacctgggcgaccgcgactgctcgctgcagcgtcgtcaccagaaggttctc
gaagaagcgcctgctccgggcatcgacgagaaggcccgccaggaagtcctcgagcgctgc
gttcgcgcgtgcatcgagatcggctatcgcggcgccggcaccttcgagttcctctacgag
aacggccgcttctacttcatcgagatgaacacccgcgtacaggtggagcacccggtgtcg
gagatggtcaccggtatcgatatcgtcaaggagatgctcagcatcgcctcgggcaacaag
ctgtcgttcaagcaggaagacgtggtcatccgtggccatgcactggaatgccggatcaac
gccgaggacccgaagaccttcctgcccagccccggcaaggtcaagcacttccacgccccg
ggcggcaacggcgtgcgcgtcgattcgcacctgtacagcggctatgccgtaccgccgaac
tacgattcgctggtgggcaagatcattgcctacggcaaggatcgtgacgaagccctggcg
cggatgcgcaatgccctggacgagctgatcgtcgacggtatcaagaccaacaccgagctg
cacaaggagctggtccgcgacaaggagttctgcaagggcggcgtgaacatccattacctg
gagaagaagctgggtatggataagcactga

DBGET integrated database retrieval system