KEGG   Pseudomonas knackmussii: PKB_1461Help
Entry
PKB_1461          CDS       T03081                                 

Gene name
hisP
Definition
(GenBank) Histidine transport ATP-binding protein HisP
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
pkc  Pseudomonas knackmussii
Pathway
pkc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pkc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PKB_1461 (hisP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pkc02000]
    PKB_1461 (hisP)
Enzymes [BR:pkc01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     PKB_1461 (hisP)
Transporters [BR:pkc02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    PKB_1461 (hisP)
   Histidine transporter
    PKB_1461 (hisP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_13 AAA_29 AAA_15 AAA_33 APS_kinase RsgA_GTPase AAA_23 G-alpha AAA_16 SUKH-4 AAA_24
Motif
Other DBs
NCBI-ProteinID: CDF82823
UniProt: A0A024HEC9
Position
complement(1506802..1507566)
Genome map
AA seq 254 aa AA seqDB search
MTTLKIDALYKRYGDNEVLKGVSLEAKTGDVVSMIGASGSGKSTFLRCINFLEQMDEGTM
SFDGEDIRMIASPGGMRVADPAQLQRIRTRLAMVFQHFNLWSHLTVLENVTLAPRRVLGV
DRKEAEDRARNYLAKVGLPAQVVDKYPAFLSGGQQQRVAIARALAMEPEIMLFDEPTSAL
DPELVGEVLKVIKALAEEGRTMILVTHEMAFAREVSSQVLFLHQGRVEEQGPPQEVLGKP
KSERLRQFLSGNLK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaccacactgaagatcgacgccctgtacaagcgctacggcgacaacgaagtcctcaag
ggcgtgtcgctggaagcgaaaaccggcgacgtggtgagcatgatcggcgccagcggctcc
ggcaaaagcaccttcctgcgctgcatcaacttcctcgagcagatggacgaaggcaccatg
agcttcgacggcgaggacatccgcatgatcgccagccccggcggcatgcgcgtggccgac
ccggcgcagctgcagcgcatccgcacgcgcctggcgatggtgttccagcatttcaacctg
tggagccacctgacggtgctggagaacgtcaccctcgccccgcgccgcgtgctcggcgtc
gaccgcaaggaagccgaggaccgcgcgcgcaactacctggccaaggttggcctgccggca
caggtggtcgacaagtacccggccttcctctccggcggccagcagcagcgcgtggccatc
gcccgcgcgctggcgatggaaccggaaatcatgctgttcgacgaaccgacctcggcgctc
gacccggaattggtcggcgaggtgctcaaggtgatcaaggccctggccgaggaaggccgc
accatgatcctggtgacccacgagatggccttcgcccgcgaggtatccagccaggtgttg
ttcctccaccagggccgcgtcgaggaacagggtccgccgcaggaagtgctgggcaagccg
aagagcgaacggctgcgacagttcctcagcggcaacctcaaatag

DBGET integrated database retrieval system