KEGG   Pseudomonas knackmussii: PKB_2329Help
Entry
PKB_2329          CDS       T03081                                 

Gene name
gcvt5
Definition
(GenBank) Aminomethyltransferase, mitochondrial
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
pkc  Pseudomonas knackmussii
Pathway
pkc00260  Glycine, serine and threonine metabolism
pkc00630  Glyoxylate and dicarboxylate metabolism
pkc00670  One carbon pool by folate
pkc01100  Metabolic pathways
pkc01110  Biosynthesis of secondary metabolites
pkc01130  Biosynthesis of antibiotics
pkc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pkc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PKB_2329 (gcvt5)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PKB_2329 (gcvt5)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PKB_2329 (gcvt5)
Enzymes [BR:pkc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     PKB_2329 (gcvt5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG DUF3659
Motif
Other DBs
NCBI-ProteinID: CDF83676
UniProt: A0A024HFM9
Position
complement(2425017..2426138)
Genome map
AA seq 373 aa AA seqDB search
MTTEILAQTPLHALHLELGARMVPFAGYEMPVQYPLGVLKEHLHTRDKAGLFDVSHMGQI
ILRGEDAAHALESLVPVDILGLAPGQQRYALFTDAEGGILDDLMVANAGDHLFLVVNAAC
KKQDLAHLRKHIGARCEIQPLFEERALLALQGPTAVEVLARLAPQVAQMTFMQFTRLPLL
GADCYISRSGYTGEDGFEISVPVAHAESLARALLADPDVQPIGLGARDSLRLEAGLCLYG
HDMNTQTTPIEAALAWAISKERRAGGARAGGFPGAERVLAQQAEGVARKRVGLLPQERMP
VREGAEIVDAEGQVIGRVCSGGFGPSLGAPLALGYLPSEFSAIGTEVWALVRGKRVPMQV
ARTPFVPQRYYRG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgaaatcctcgcgcaaaccccgctgcacgccctgcaccttgaactgggcgcg
cgcatggtgcccttcgccggctacgagatgccggtgcaataccccctcggcgtgctcaag
gagcacctgcatacccgcgataaggctggcctcttcgacgtctcacacatgggccagatc
atcctgcgcggcgaggacgccgcccacgccctggaaagcctggtgccggtcgacatcctc
ggcctcgcgccgggccagcagcgctacgcgctgttcaccgacgccgagggcggcatcctc
gacgacctgatggtggccaacgccggcgaccacctgttcctggtggtcaacgcggcctgc
aagaagcaggacctggcgcacctgcgcaagcacatcggcgcccgctgcgaaatccagccg
ctgttcgaggaacgcgccctcctcgccctgcaaggcccgaccgccgtcgaggtgctcgcg
cgcctcgccccgcaggtcgcgcagatgaccttcatgcagttcacccgcctgccgctgctg
ggcgccgattgctacatcagccgctccggctacaccggcgaggacggcttcgagatttcc
gtgccggtcgcgcacgccgaatccctggcccgcgccctgctggccgatccggacgtgcag
cccatcggcctcggcgcgcgcgactcgctgcgcctggaagccggcctgtgcctctacggc
cacgacatgaacacccagaccacgcccatcgaagcggcgctggcctgggccatctccaag
gagcgccgcgccggtggcgcgcgggccggcggtttccccggcgccgagcgggtgctggcg
cagcaggccgaaggcgtggcgcgcaagcgcgtcgggctgctgccgcaggagcgcatgccg
gtgcgcgaaggcgcggagatcgtcgatgccgaaggccaggtgatcggccgcgtgtgcagc
ggcggcttcggccccagcctgggcgcgccgctcgccctgggctacctgcccagcgagttc
agcgccataggcaccgaggtctgggcgctggtgcgcggcaagcgcgtgcccatgcaggtg
gcgcgcacgcccttcgtgccgcagcgctactaccgcggttga

DBGET integrated database retrieval system