KEGG   Pseudomonas knackmussii: PKB_2338Help
Entry
PKB_2338          CDS       T03081                                 

Definition
(GenBank) permease for cytosine/purines uracil thiamine allantoin
Organism
pkc  Pseudomonas knackmussii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transp_cyt_pur
Motif
Other DBs
NCBI-ProteinID: CDF83685
UniProt: A0A024HF61
Position
2438229..2439734
Genome map
AA seq 501 aa AA seqDB search
MKSDPKVLPLPEAQRGLEIEGHSIDFIEEHERTDKLSTQGPFWFVGNFTFFTMTIGFVGP
SVGLNAMWTMIAGTLGIMFGTLFMAFHGSQGPHLGLPQMIQSRAQFGYRGVILVLLATLF
VFAGFNIVNLVLMMQGLHTLFQWGPMQVALAVSVPATLLAILGHDWMHKTFKWSLFLSLP
LYGLISVAVLMGWIHSTPAAAGTPEAVALGFTWTGFVAQFAAGASYNIAYAPYVSDYSRY
LPKNTSSGKLIAAVFVGASLSGAWMIAVGGWLAEHLHATDVLVALNAVGASFAPQLGTVV
VAVTILAFLPVIAMNIYSAKLTTITGLDSFRKVKPTASVRIWAILFVVLLQLGVAIAINA
SGSGLSMLNMYLVVMLYFLVPWTAVNLTDYFFVRKGRYAIPHFFLPHDNIYGHWGSRGLV
AYLIGFVVMIPFFTIYNGADEVFVGPLAKAIGGVDMAWLVGLIVSGVAYYLLCLSLDLEK
EEKLIRHIESTSPHFSTGKTW
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcagatccgaaagtgctgccgctccccgaggcgcagcgcgggttggaaatcgaa
ggacactccatcgatttcatcgaggaacacgagcgcaccgacaagctctcgacccagggc
ccgttctggttcgtcggtaacttcaccttcttcaccatgaccatcggcttcgtcggcccc
agcgtcggcctgaacgccatgtggacgatgatcgccggcaccctcggcatcatgttcggc
accctgttcatggccttccacggctcccagggcccgcacctgggcctgccgcagatgatc
cagtcgcgcgcgcagttcggctaccgcggggtcatcctggtgctgttggccacgctgttc
gtcttcgccggcttcaacatcgtcaacctcgtgttgatgatgcaggggctgcacacgctg
ttccaatgggggccgatgcaggtggccctggcggtctcggtgccggcgaccctgctggcg
atcctcggccacgactggatgcacaagaccttcaagtggtcgctgttcctttccctgccg
ctctacgggctgatctcggtcgccgtgctgatgggctggatccactccacgccggccgcc
gcgggtacgcctgaagcggtagccctgggcttcacctggaccggcttcgtcgcccagttc
gccgccggcgccagctacaacatcgcctacgcgccctacgtctcggactactcgcgctac
ctgccgaagaacacctccagcggcaagctgattgccgccgtgttcgtcggtgcctcgctg
tccggcgcctggatgatcgccgtcggcggctggctggccgagcacctgcacgccaccgat
gtcctggtcgcgctgaacgcggtgggcgccagcttcgcgccgcagctgggcaccgtggtg
gtggccgtcaccatcctggcgttcctgccggtgatcgcgatgaacatctacagcgccaag
ctcaccaccatcaccggcctcgactcgttccggaaggtcaagccgaccgccagcgtgcgc
atctgggcgatcctcttcgtggtgctgctgcaactgggcgtggccatcgccatcaacgcc
tccggctccggcctgtcgatgctcaacatgtacctggtggtgatgctgtacttcctggtg
ccctggaccgcggtcaacctcaccgactacttcttcgtgcgcaagggccgctacgccatc
ccgcacttcttcctgccccacgacaacatctacgggcactggggtagccgtgggctggtc
gcctacctgatcggcttcgtggtgatgatcccgttcttcaccatctacaacggcgccgac
gaggtcttcgtcggacccctggccaaggccatcggcggtgtcgacatggcctggctggtc
ggcctgatcgtctccggcgtcgcctactacctgctgtgcctgtcgctcgacctggagaaa
gaggaaaagctcattcgccacatcgagagcacctccccgcatttctccaccggcaagacc
tggtaa

DBGET integrated database retrieval system