KEGG   Pseudomonas knackmussii: PKB_3133Help
Entry
PKB_3133          CDS       T03081                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pkc  Pseudomonas knackmussii
Pathway
pkc00071  Fatty acid degradation
pkc00072  Synthesis and degradation of ketone bodies
pkc00280  Valine, leucine and isoleucine degradation
pkc00310  Lysine degradation
pkc00362  Benzoate degradation
pkc00380  Tryptophan metabolism
pkc00620  Pyruvate metabolism
pkc00630  Glyoxylate and dicarboxylate metabolism
pkc00640  Propanoate metabolism
pkc00650  Butanoate metabolism
pkc00900  Terpenoid backbone biosynthesis
pkc01100  Metabolic pathways
pkc01110  Biosynthesis of secondary metabolites
pkc01120  Microbial metabolism in diverse environments
pkc01130  Biosynthesis of antibiotics
pkc01200  Carbon metabolism
pkc01212  Fatty acid metabolism
pkc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pkc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PKB_3133
   00630 Glyoxylate and dicarboxylate metabolism
    PKB_3133
   00640 Propanoate metabolism
    PKB_3133
   00650 Butanoate metabolism
    PKB_3133
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PKB_3133
   00072 Synthesis and degradation of ketone bodies
    PKB_3133
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PKB_3133
   00310 Lysine degradation
    PKB_3133
   00380 Tryptophan metabolism
    PKB_3133
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PKB_3133
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PKB_3133
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PKB_3133
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pkc04147]
    PKB_3133
Enzymes [BR:pkc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PKB_3133
Exosome [BR:pkc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PKB_3133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CDF84480
UniProt: A0A024HHH8
Position
complement(3312414..3313598)
Genome map
AA seq 394 aa AA seqDB search
MNDPVVIVSIARTPMGGFLGDFKDASAATLGAAAVRAAIERAQLGADQIDDAILGCVLSA
GQGQAPARQAVLGAGLDRGTPCTTINKMCGSGMKAVMQGHDALLAGSASVVLAGGMESMS
NAPYLLERARIGYRMGHGKVLDHMFLDGLEDAYDRGRLMGTFAEDCAEAYGFTRQQQDDY
AIASLTRAQQAMSAGRFAAEITPVTVKAGKETREVSQDEQPPKAKLDKIPTLKPAFREGG
TVTAANSSSISDGAAALVLMRLSKAEKHGLKPLAAIRGHSSYAAAPNLFPTAPVGAMRRL
LQRTGWALGDVDLFEINEAFAVVAMAAMRELDIPHAKLNVHGGACALGHPIGASGARILV
TLLSALQQYDLDRGIASVCIGGGEATAIAVQRLS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatcccgtagtcatagtcagcatcgcccgcacccccatgggcggcttcctcggc
gacttcaaggacgccagcgccgccaccctcggcgccgccgccgtgcgcgccgccatcgaa
cgcgcacagctaggcgccgaccagatcgacgacgccatcctcggctgcgtgctttccgcc
ggccagggccaggccccggcgcgccaggcggtgctcggcgccggcctggaccgcggcacg
ccctgcacgacgatcaacaagatgtgcggctcgggcatgaaggccgtgatgcagggccat
gacgcactgctcgccggcagtgccagcgtggtgctggcgggcggcatggagagcatgtcc
aacgccccgtacttgctggagcgcgcacgcatcggctaccgcatgggccacggcaaggtg
ctcgaccacatgttcctcgacggcctcgaagacgcctacgaccggggtcgcctgatgggc
accttcgccgaggattgcgccgaggcttacggctttacccgccagcagcaggatgactac
gccatcgcctcgctgacccgcgcgcagcaggccatgagcgcagggcgcttcgccgccgag
atcaccccggtgacggtcaaggccggcaaggaaacccgtgaggtgagccaggacgagcag
ccgccgaaggcgaagctggacaagattccgaccctgaaaccggccttccgcgagggcggc
accgtgaccgccgccaactccagctccatctccgacggcgccgccgcgctggtgctgatg
cgcctgtccaaagccgagaagcatggcctgaagccgctggcggcaattcgtggacattcg
tcctacgccgcagcgccgaacctgttcccgaccgcaccggtcggcgccatgcgccgcctg
ctgcaacgtacgggctgggccttgggcgacgtggacctgttcgagatcaacgaggccttc
gccgtggtcgccatggcggcgatgcgcgagctggacattccccacgcaaagctcaacgtc
cacggcggcgcctgcgccctgggccacccgatcggcgcttccggcgcgcgcatcctggtg
accctgctgtcggcgctgcagcagtacgacctcgatcgcggcatcgcctcggtgtgcatc
ggcggcggcgaagccaccgccatcgccgtccagcgcctgagctaa

DBGET integrated database retrieval system