KEGG   Pseudomonas knackmussii: PKB_3256Help
Entry
PKB_3256          CDS       T03081                                 

Gene name
amng1
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase 2
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
pkc  Pseudomonas knackmussii
Pathway
pkc00360  Phenylalanine metabolism
pkc00362  Benzoate degradation
pkc00621  Dioxin degradation
pkc00622  Xylene degradation
pkc01100  Metabolic pathways
pkc01120  Microbial metabolism in diverse environments
pkc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pkc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    PKB_3256 (amng1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PKB_3256 (amng1)
   00622 Xylene degradation
    PKB_3256 (amng1)
   00621 Dioxin degradation
    PKB_3256 (amng1)
Enzymes [BR:pkc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     PKB_3256 (amng1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm FMN_dh Glyco_trans_4_5
Motif
Other DBs
NCBI-ProteinID: CDF84601
UniProt: A0A024HIB6
Position
complement(3438172..3439209)
Genome map
AA seq 345 aa AA seqDB search
MSINGNAAASKLYISDVTLRDGSHAIRHQYSVPQVRQIALALDEARVDSIEVAHGDGLQG
SSFNYGFGAHTDVEWIEAVADVVKHAKIATLLLPGIGTVHDLQAAYNAGARIVRVATHCT
EADVSRQHIELARKLDMDTVGFLMMSHMSSPQALAEQAKLMESYGATCCYVVDSGGAMNM
NDVRDRVLALREVLQPETAIGIHAHHNLSLGVANSIVAVEAGAIRVDASLAGMGAGAGNA
PLEVFIAAAERMGWQHGTDLYRLMDAADDIVRPLQDRPVRVDRETLALGYAGVYSSFLRH
AEAAGHKYGLKTVDILVELGKRRMVGGQEDMIVDVALDLAQQTTT
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcaacgggaacgccgcagcgtccaagctttatatttccgacgtcactttgcgc
gatggaagccacgctatccgccatcaatactctgtgcctcaggtacgtcagatcgccctg
gcgctggacgaggcccgcgttgactccatagaggtcgcgcacggggatggccttcagggt
tcgagcttcaactacggctttggcgctcacaccgacgtggaatggatcgaagctgtagcc
gatgttgtgaagcacgccaagatcgcgacactcctgctgccaggcataggcaccgtgcat
gatctgcaggccgcgtacaacgccggcgcgcgcatcgtgcgtgtcgccacccactgcact
gaagccgatgtgtcgcgccagcacatcgaactcgctcgcaagctggacatggacacggtg
ggcttcctaatgatgagtcacatgtcctcgccgcaagctctggctgagcaggccaagctc
atggaaagctacggcgcgacctgctgctatgtcgtcgattccggcggcgcgatgaacatg
aacgatgttcgagatcgtgttctcgcgctgcgtgaagtcttgcagccggaaactgccatt
gggattcatgcgcatcacaatctcagcctcggcgtggccaattccatcgtggccgtagaa
gcaggcgctatccgtgtcgacgcaagcctggctggcatgggcgcgggtgccgggaatgcg
ccgttggaggtattcatcgccgccgcggaacgcatgggctggcagcatggtacggacctg
tacagattgatggatgccgccgatgacatcgttcgccctctgcaagatcgtccagtgcgt
gttgatcgagagacgctcgcgctcggctatgccggtgtctacagctcattcctgcggcac
gccgaggccgccggtcacaagtatggtctgaagacggtcgatattctggtggagcttggc
aagcgtcgtatggttggtgggcaagaagacatgatcgtcgatgtggcgctcgatttggca
caacagacgacaacgtag

DBGET integrated database retrieval system