KEGG   Pseudomonas knackmussii: PKB_4955Help
Entry
PKB_4955          CDS       T03081                                 

Gene name
atob3
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pkc  Pseudomonas knackmussii
Pathway
pkc00071  Fatty acid degradation
pkc00072  Synthesis and degradation of ketone bodies
pkc00280  Valine, leucine and isoleucine degradation
pkc00310  Lysine degradation
pkc00362  Benzoate degradation
pkc00380  Tryptophan metabolism
pkc00620  Pyruvate metabolism
pkc00630  Glyoxylate and dicarboxylate metabolism
pkc00640  Propanoate metabolism
pkc00650  Butanoate metabolism
pkc00900  Terpenoid backbone biosynthesis
pkc01100  Metabolic pathways
pkc01110  Biosynthesis of secondary metabolites
pkc01120  Microbial metabolism in diverse environments
pkc01130  Biosynthesis of antibiotics
pkc01200  Carbon metabolism
pkc01212  Fatty acid metabolism
pkc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pkc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PKB_4955 (atob3)
   00630 Glyoxylate and dicarboxylate metabolism
    PKB_4955 (atob3)
   00640 Propanoate metabolism
    PKB_4955 (atob3)
   00650 Butanoate metabolism
    PKB_4955 (atob3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PKB_4955 (atob3)
   00072 Synthesis and degradation of ketone bodies
    PKB_4955 (atob3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PKB_4955 (atob3)
   00310 Lysine degradation
    PKB_4955 (atob3)
   00380 Tryptophan metabolism
    PKB_4955 (atob3)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PKB_4955 (atob3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PKB_4955 (atob3)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PKB_4955 (atob3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pkc04147]
    PKB_4955 (atob3)
Enzymes [BR:pkc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PKB_4955 (atob3)
Exosome [BR:pkc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PKB_4955 (atob3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CDF86270
UniProt: A0A024HMI7
Position
5219460..5220638
Genome map
AA seq 392 aa AA seqDB search
MQDVVIVAATRTAIGSFQGSLSSLPAHELGAAVIRQLLAQSGVAADQVDEVILGQTLTAG
AGQNPARQAAIAAGLPNSVPAMTINKVCGSGLKALHLAAQAIRCGDAEVMIAGGQESMSL
APYVMPGARTGLRMGHAKLVDSMIQDGLWDAFNDYHMGITAENLVAKYEISREEQDAFAA
ESQRKAAEAVAAGRFEAEITPIEIPQRKGEPLRFVVDEQVRAGTTADALGKLKPAFKKDG
SVTAGNASTLNDGAAAVLLMSAAKAKALGLPVLARIAAYANAGVDPAIMGIGPVSATRRC
LEKAGWALADLDLIEANEAFAAQALAVGKELGWDAAKVNVNGGAIALGHPIGASGCRVLV
TLLHEMLRRDAKKGLATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatgtcgtcatcgtcgctgccacccgtaccgccatcggcagcttccagggctcc
ctttcgtccctgcccgcccacgaactgggcgccgcggtgatccgccaactgctcgcacag
agcggcgtggccgcggatcaggtcgatgaagtcatcctcggccagaccctcaccgccggc
gccgggcagaaccccgcgcgccaggccgccatcgccgccggcctgcccaacagcgtgccg
gccatgaccatcaacaaggtctgcggctccggcctcaaggcgctgcacctggccgcccag
gcgattcgctgcggcgacgccgaagtgatgatcgccggcggtcaggaaagcatgagcctc
gccccctatgtcatgcccggcgcccgcaccggcctgcgcatgggccacgccaagctggtc
gacagcatgatccaggacggcctgtgggatgccttcaacgactaccacatgggcatcacc
gccgagaacctggtggccaagtacgagatcagccgcgaagagcaggacgccttcgccgcc
gagtcgcagcgcaaggccgccgaggctgtcgctgccggtcgcttcgaggcggaaatcacc
cccatcgagattccccagcgcaagggcgagccgctgcgcttcgtcgttgacgagcaggtt
cgcgccggcaccaccgccgacgccctgggcaagctcaagccggccttcaagaaggacggc
agtgtcaccgccggcaatgcctcgaccctcaacgacggcgccgccgccgtgctgctgatg
agtgcggccaaagcaaaggccctgggtctgccggtgctggcgcgaatcgccgcctacgcc
aatgctggtgtcgacccggcgatcatgggcatcggccctgtgagcgccacccgtcgctgc
ctggagaaggccggctgggcgctggccgacctcgacctgatcgaagccaacgaagccttc
gccgcccaggccctggcagtgggcaaggagctcggctgggacgcggccaaggtcaacgtc
aacggcggtgccatcgccctcggccacccgatcggggcctccggctgccgggtgctggta
acgctgctccatgaaatgctccgtcgcgatgcaaagaagggcctggcgaccctgtgcatc
ggcggcggccagggtgtcgccctggccatcgagcgctga

DBGET integrated database retrieval system