KEGG   Pseudomonas knackmussii: PKB_5269Help
Entry
PKB_5269          CDS       T03081                                 

Gene name
psd
Definition
(GenBank) Phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
pkc  Pseudomonas knackmussii
Pathway
pkc00564  Glycerophospholipid metabolism
pkc01100  Metabolic pathways
pkc01110  Biosynthesis of secondary metabolites
Module
pkc_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:pkc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PKB_5269 (psd)
Enzymes [BR:pkc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     PKB_5269 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: CDF86581
UniProt: A0A024HP18
Position
5536479..5537348
Genome map
AA seq 289 aa AA seqDB search
MSFKDRLFILAQYLLPHHLLSRLIGCAAECRAAWFKDRLIPWFARRYQVDMREAQVEDLR
AYEHFNAFFTRALKDGARPLDETPAGVLCPADGAISQLGPIEHGRVFQAKGHSFSLTELL
GGDAERAAPFMGGEFATVYLSPKDYHRVHMPLAGTLREMVYVPGRLFSVNQLTAEQVPEL
FARNERVVCLFDTERGPMAVVLVGAMIVASIETVWAGLVTPPKRELKAFAYDEAARAPIH
LEKGAELGRFKLGSTAIVLFGPEQVGWAEQLAAGSPVRMGQLLGKARQV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcaaagaccgtttgttcatcctggcccagtacctgctgccgcatcacctgctg
tcgcgcctgatcggctgcgccgccgagtgccgcgcggcctggttcaaggaccgcctgatt
ccctggttcgctcgccgttaccaggtcgacatgcgcgaagcgcaagtcgaagacctgcgt
gcctacgagcacttcaatgcgttcttcacccgcgccctgaaagacggcgcgcggccgctg
gatgaaaccccggccggcgtgctctgcccggccgacggcgcgatcagccagctcggcccg
atcgaacacggccgcgtcttccaggccaagggccacagcttcagcctgaccgaactgctg
ggcggcgacgccgagcgcgccgcgcccttcatgggcggcgagttcgccaccgtctacctg
tcgccgaaggactaccaccgcgtgcacatgccgctggccggcaccctgcgcgagatggtc
tacgtgcccggccggctgttctcggtgaaccagctgaccgccgagcaggtacccgagctt
tttgctcgaaacgagcgcgtcgtctgcctgttcgataccgaacgtggtccaatggccgtg
gtgctggtcggtgccatgatcgtcgcctcgatcgaaaccgtctgggccggcctggtcacg
ccgccgaagcgcgagctgaaggccttcgcctacgacgaagcggcacgcgcgcccatccac
ctggagaaaggcgccgagctgggccgcttcaagctcggctccaccgccatcgtcctgttc
ggaccggagcaggtaggctgggctgaacaactggccgccggcagcccggtgcgcatgggc
caactgctgggcaaggcccgccaggtctga

DBGET integrated database retrieval system