KEGG   Paramormyrops kingsleyae: 111832738Help
Entry
111832738         CDS       T05788                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00232  Caffeine metabolism
pki00983  Drug metabolism - other enzymes
pki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    111832738
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    111832738
Enzymes [BR:pki01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     111832738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 111832738
NCBI-ProteinID: XP_023646175
Ensembl: ENSPKIG00000000263
Position
Unknown
AA seq 293 aa AA seqDB search
MDRMNVADYLQRIGYKGPFQKADLETLNQIHKLHVDSIPFENLSIHCGEKITMDLAVIYD
KIIRKNRGGWCCENNYLFSWVLKELGYNNTVLGSRVFNNFLNQYNPRESHFINKIDIDGV
SYIADVSFGVSGQIWQPLELTVDKDQPQLPGVFRLIKADGMWVLQKTSRKQIIPNEAFAK
SDLLNKSITKKIYGFTLAPRQPEHFMETIQFLQTSPESLFVQKSICSLQTPTGFHALIGW
TYTEVTYNYEEGADLFNIENIPKEEVETVLKDKFNLLLEKRLVPLNNKAAYTL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggatagaatgaatgtggcagattacttgcagcggattgggtataaaggcccctttcaa
aaagccgacctggagaccctgaaccagatccacaagctgcatgtagattccatccctttt
gagaatctcagcatacactgtggagagaagatcaccatggacctggccgttatctatgac
aagattataaggaagaaccgtggaggctggtgctgtgagaacaactatctcttttcctgg
gtgctgaaggagctgggctacaacaacacagttttggggtcgagggtcttcaacaacttt
ctgaaccagtacaatcccagggagagccacttcatcaataaaattgacatcgatggtgtg
tcatacattgccgacgttagcttcggggtgtctggtcagatctggcagccccttgagctt
acggtggataaggaccagccacagctgcccggagtcttccgcttaataaaggccgacgga
atgtgggttttgcagaaaacgagtagaaagcaaataattccaaatgaagcatttgccaag
tctgacctgttgaataaaagcatcacaaaaaaaatctatgggttcaccttggcaccacgt
cagcctgaacactttatggagaccatccaattcctccagacctccccagagtcattattt
gtgcaaaagtccatctgctccctacagacacccactgggttccatgctctcattggctgg
acctacactgaggtcacctataactatgaggaaggtgctgatctattcaacattgaaaat
ataccgaaagaagaagtggaaacagttttgaaagacaagtttaatctcttgttagaaaaa
agacttgttcctttaaacaacaaggctgcatatacactctaa

DBGET integrated database retrieval system