KEGG   Paramormyrops kingsleyae: 111833206Help
Entry
111833206         CDS       T05788                                 

Definition
(RefSeq) band 3 anion exchange protein-like isoform X1
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pki02000]
    111833206
   04147 Exosome [BR:pki04147]
    111833206
   04090 CD molecules [BR:pki04090]
    111833206
Transporters [BR:pki02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   111833206
Exosome [BR:pki04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111833206
CD molecules [BR:pki04090]
 Proteins
  111833206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2
Motif
Other DBs
NCBI-GeneID: 111833206
NCBI-ProteinID: XP_023646989
Ensembl: ENSPKIG00000018714
Position
Unknown
AA seq 834 aa AA seqDB search
MKDENQQRYWQDSGRWAGYEESYDPEAGGWSPSHIFYLTLKSLVQLCRIMSTGAVMLDQE
ERSLASIAEKLVDELVDKNEIRPSDREELLKALLQNRSQSEPKETQTLAPGLEMTCSVSG
KKDVSDTSEASMVLVGALDFLEKPTVAFVRLKEAAELESALKAPVPVRFVFVLVGPNDNS
MDYHEIGRAMATLMADRVFNLAAVQAQNDRDLMEAVAEFMDCSIVIPPTEIQNESVLSSI
IGFQKQLLHRRLSPSSPQVSLDLKPHRVTKAERPPAEDPLARTGRPFGGMIKDFKRRYKH
YVSDITDGLNLQVLAAIIFIYFAALSPAITFGGLLADKTDNMMGISELLLSTALQGIIFC
LIAAQPILVIGFSGPLLVFEEAFFAFCNSQEIEYIVGRVWIGFWLVFIVVLMVAFEGSFL
VRFISRFTQEIFSILISLIFIYETFAKLIRVFQQHPLTRNYEYLNRSAGNPFYAAPSRHS
GNASTLATLQEKAYPNTALLSMCLMFGCFFIAYFLRQFKNGHFLPGKIRRLIGDFGVPIA
IFLMIVVDISIQDVYTQKLLVPKGLTVSNPSARGWVINPLGIKRAFPVWMMIASVIPAML
VFILIFLESQITTLIVSKPERKMVKGSGFHLDLLILVSMGGLGAMLGLPWLSAATVRSVT
HANALTVMSKGPKPVIEKVLEQRVSGILVALLVGLSILMEPILKMIPITALFGIFLYMGI
TSLSGIQLWDRILLLFIPRKYHPQEPYATKVKTNKMHIFTLIQVACLVALWIVKSSPISL
ALPFILILTIPLRMLMRGRLFTELEMKCLDTDDAKVTFEEEPGHDVYSESQMPL
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacgagaaccagcagcgctactggcaggactcagggagatgggcagggtatgaa
gaaagctatgatcctgaggcagggggctggagtccctctcacatcttctacctgacctta
aagagcttggttcagctgtgtaggatcatgagcacaggtgcggtgatgttggaccaagag
gagcgtagcctggccagcatcgctgagaagctggtggatgagcttgtggacaaaaacgag
atccggcccagtgaccgtgaggagctcctgaaagccttgctacagaaccggagtcagtct
gagccaaaagagacccagactctggcccctggtttggagatgacatgttcagtgtcaggc
aagaaagatgtatctgacaccagtgaagcttcaatggtcctggttggagccctggatttt
ttagagaagcccactgtagctttcgtgaggctgaaggaggcggcggagttggaatcggct
ttgaaggccccggtgccggtccgctttgtgtttgtgttggtggggcccaatgacaacagc
atggactaccatgaaatcggacgagccatggccacattaatggctgacagggtgttcaat
ttagcagctgtccaagcgcagaacgatcgtgacctgatggaggctgttgcagaattcatg
gactgcagcatcgtgatcccacctactgagatccagaatgaatcagtgctgagctccatt
attggctttcagaaacagcttctgcaccgacgcctgagcccatccagcccccaggtctcc
ttggacttgaagcctcacagagttacaaaagcagagagacctccagcagaggacccgctg
gcccgcacaggccggccattcggtggaatgatcaaggactttaagaggcgctacaagcac
tatgtcagtgacatcactgatggcctcaatctccaggtcctagctgctatcatcttcatc
tactttgctgctctgtctcctgccatcacgtttggaggtctgttggctgataaaacagat
aacatgatgggcatatccgagctgctgctgtctactgctctacagggaataatcttctgt
ctcatcgctgctcagccaatcctggtcatcggcttttctggacccttgttggtctttgag
gaggccttttttgcgttctgcaactcacaagagatcgagtacattgtgggccgagtgtgg
attggcttttggctggtgtttatcgtggtattaatggtggcattcgagggcagctttctg
gtcaggttcatttcacgcttcacacaagagatcttctccatcttaatatccctcatcttc
atctatgagacctttgccaaactcatcagggtttttcagcagcacccactgactcgtaac
tatgaatatctgaacaggagtgcagggaatcccttttacgctgcccctagccgtcactct
ggcaacgcctccaccctggctacactccaggaaaaagcatatcccaacactgccttgctc
tccatgtgcctaatgtttgggtgtttcttcattgcgtatttcctcagacagttcaaaaat
ggacatttcctaccaggcaagatccgccgcttgattggagactttggtgtccctattgcc
attttcttaatgattgttgtggacatcagcattcaagatgtttacactcagaaacttctg
gtgcccaaaggtctgacagtgtccaaccccagtgcaagggggtgggtaatcaacccattg
gggataaagagagctttccctgtctggatgatgatagccagtgtcatcccagcgatgctc
gtctttatcctcatattcctagagtctcagatcactacactgattgtgagcaagccagag
cggaagatggtgaagggctcgggattccacctcgacctgctaattctagtcagcatgggg
ggccttggtgccatgttagggttgccctggctgagtgctgccactgtccgttcagtcact
catgccaatgctctgactgtcatgagcaaaggaccaaaaccagtgattgaaaaagttctg
gagcagagagtaagcggcatattggtagctctgctggtcggtctgtcgattttaatggag
cctattttaaaaatgatccccataacagctctgtttgggatatttctctacatgggtatt
acctcactcagtggaatccagctttgggaccgcatactgctgcttttcatacccagaaag
tatcatcctcaggaaccatatgccaccaaggtgaagaccaataagatgcacatatttact
ttgatccaagtagcatgtttggtggcactgtggatagtgaaatccagccccatctccctg
gctctgcccttcatcctcatcctcaccattcccctgcgcatgttaatgagaggccgcctc
ttcactgagctggaaatgaaatgtctggatactgatgatgccaaggtaacatttgaggag
gagccaggacatgatgtgtacagtgaatcccagatgccactatag

DBGET integrated database retrieval system