KEGG   Paramormyrops kingsleyae: 111833583Help
Entry
111833583         CDS       T05788                                 

Gene name
ctso
Definition
(RefSeq) cathepsin O
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04142  Lysosome
pki04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:pki00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    111833583 (ctso)
  09143 Cell growth and death
   04210 Apoptosis
    111833583 (ctso)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pki01002]
    111833583 (ctso)
Enzymes [BR:pki01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     111833583 (ctso)
Peptidases [BR:pki01002]
 Cysteine Peptidases
  Family C1: papain family
   111833583 (ctso)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Peptidase_C1_2 Inhibitor_I29 Peptidase_C39_2
Motif
Other DBs
NCBI-GeneID: 111833583
NCBI-ProteinID: XP_023647782
Ensembl: ENSPKIG00000015268
Position
Unknown
AA seq 375 aa AA seqDB search
MRLQRHHMTAVDVRLVCVAPVRLGSDPMAGLGVVCLLTLIALTLLRGAVFASKEDVVFSG
SSSIVSEATNAFDLFKKLFNWSNEPGTDDYYRRIINLEKSLLRHASLNNHSVASNSSSAK
YGINQFSVLSPEEFRDRFLTTIPEKVPEYPAPEAARGPSIKLPKKFDWREKNVVTPVENQ
ESCGGCWAFSVVGIIESVYALLGHPLRQLSVQQVIDCSYKNQGCNGGSTVRTLSWLKQTQ
EKLVSETEYPFKAETGVCRIFPPSEFGVSVKDFAAFDFSENEVAMMQKLLDWGPVAVTVD
AVSWQDYLGGIIQHHCPSQQANHAVLITGYDTTAEVPYWIVRNSWGTSWGNQGYVYIKMG
GNVCGVADSVAAVFV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctacagcgacatcacatgacagcagtcgatgttcggctcgtctgtgtcgctccg
gttcgtttgggttcggatccgatggctgggcttggggtggtgtgtctcctgacattaatc
gccctcaccctgttgaggggcgccgtcttcgcctcaaaagaggacgttgtattcagcggt
agcagttctattgtttcggaagcaaccaacgccttcgacctttttaaaaagttgttcaac
tggagcaatgagcccggtactgatgattattatcgcaggattattaacctggagaaaagc
ctcctacggcatgcatctctgaacaatcactcagtcgcctcaaacagctcctctgcaaaa
tacggaataaaccagttttctgttttatcgccagaagaattcagagaccggtttctgacc
acaatcccggagaaggtgccggagtacccagcaccagaggctgcaagaggcccttcaatc
aaactgcctaagaaatttgactggagagagaagaatgttgtcactccagttgaaaaccaa
gaatcatgtggaggctgctgggcgttcagcgtggtcgggatcatcgaatctgtctacgcg
ctgctgggccaccctctgcggcagctgagtgtgcagcaggtcatcgattgctcatataaa
aaccagggctgcaacggtggctccaccgtcaggaccctcagctggctgaagcagacacag
gagaaattggtcagtgagacagagtacccatttaaagctgaaacaggagtctgtcgcatt
ttcccaccatcagaatttggagtttctgttaaggactttgcagcttttgacttcagtgaa
aacgaggtggcgatgatgcagaagctgctggattggggtcctgtagctgtaacagtggat
gctgtcagttggcaagactaccttgggggcataatccagcaccactgccccagccagcag
gccaaccatgccgtcctcatcaccggatacgataccacagctgaggttccctactggatt
gtgcgtaactcttggggaacatcatggggaaaccagggttacgtctatatcaagatggga
ggcaacgtctgtggtgtcgccgatagtgtggctgctgtttttgtgtga

DBGET integrated database retrieval system