KEGG   Paramormyrops kingsleyae: 111833868Help
Entry
111833868         CDS       T05788                                 

Definition
(RefSeq) myotubularin-related protein 2-like
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00562  Inositol phosphate metabolism
pki01100  Metabolic pathways
pki04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111833868
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    111833868
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pki01009]
    111833868
Enzymes [BR:pki01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     111833868
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     111833868
Protein phosphatases and associated proteins [BR:pki01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    111833868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM Y_phosphatase 3-PAP DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 111833868
NCBI-ProteinID: XP_023648320
Ensembl: ENSPKIG00000022570
Position
Unknown
AA seq 635 aa AA seqDB search
MEKSGSADSLGSKRSSSRQPSVDSLTSTNTTRSDRSAHLRSAVSPDAASARTDLGAEVLK
ESSRIAEGELQLLPRESVQDTASDVTYICPFLGAIRGSLTVTNYRLFFKCLDKDPAFVLD
LPVGVISRVEKIGAISAQGEVSFGLVCKDIRNLRFAHRYQEGSLKKSIFELVNKFAFPVS
NALRMFAFEYGQPFPENGWKVYDPLAEYKRQGLPNESWRITKANEHYDVCETYPATLVVP
ANIPDEELKRVAAFRAKGRIPVLSWIHPETQATVTRCSQPMVGVNGKRSKEDEKHLQAIM
DANAQSHKLFIFDARPPVNAAANKMKGGGFESEDAYQNAELVFLDIHNIHVMRESLRKLK
EVVYPNIEESHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQL
SSLAMLMLDGFYRTLRGFQVLVEKEWLSFGHRFQLRIGHGDRNHTDADRSPVFLQFIDCV
WQMTRQFPAAFEFNEFFLITILDHLYSCLFGTFLCNSEQQRLEEDLPKRTVSLWSYINSQ
HEEFTNPLYVDYANHVLYPVVSMRHLELWVGYYIRWNPRMRPQEPLHQHYRELLAKRAEL
QRKVEELQREVAGRVAVAPPEKAGSPAGSPVQTCV
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggagaagagcggcagcgccgacagtctgggctccaagcgctcctcgtcccggcagccg
agcgtagattccttgaccagcacgaatacgacccggtccgaccgctcagctcacctgagg
tccgccgtgtccccggacgccgcgtccgcccgcaccgacctgggcgccgaggtgctcaag
gaatcgagtagaattgccgaaggagaactgcagttactgccgagggagtcggtgcaggac
acggctagcgatgtgacgtacatctgtccctttctgggtgccattcggggatctctgacc
gtgactaattaccggctttttttcaaatgcttggacaaggatcctgcgtttgtcctggac
cttcctgtgggggtcatcagccgggtggagaagatcggggccatctccgcgcagggggag
gtctctttcggcttggtctgcaaggacatccgtaatctccgattcgcacataggtaccaa
gagggatccctcaagaaatccatctttgagcttgtgaacaaatttgccttccccgtctca
aacgccttgcgaatgtttgcctttgaatacgggcagcccttccctgagaacggctggaaa
gtctacgaccctctggcagagtacaagagacagggtttgcctaacgagagctggaggata
acgaaggcgaacgagcattacgacgtgtgcgagacttaccccgccaccctggtggtgcct
gccaacatccccgatgaggagctgaagagagtggcggccttcagagccaagggccgcatt
ccggtgctgtcctggatccaccccgagacgcaggcgacggtgacgcgctgcagccagccc
atggtgggggtcaacggcaagcgcagcaaggaggacgagaagcacctgcaggccatcatg
gacgccaacgcccagtcgcacaagctgttcatcttcgacgcgcggccccccgttaacgcc
gccgctaacaagatgaagggaggcggcttcgagagcgaggacgcctaccagaacgctgag
ctggtcttcctggacatccacaacatccatgtgatgcgtgagtctctgcgcaagctgaag
gaggtggtgtaccccaacatcgaagaatcccattggctctccaaccttgagtccactcat
tggctggagcacatcaagctgatcctggcgggggcactgcgtatcgcggacaaggtggag
tcggggaagacgtcagtggtggtgcactgtagcgacggctgggaccgcactgcgcagctg
agctcgctggccatgctgatgctggacggcttctaccgcacactcaggggcttccaggtg
ctcgtggagaaggagtggctcagcttcggacacaggttccagctgaggatcggacacggg
gacaggaaccacacagatgccgaccgctcacccgtcttcctgcagttcatcgactgcgtg
tggcagatgacgcggcagttccccgcagcatttgagttcaacgagttcttcctgatcacc
atcttggaccatctgtacagctgcctgtttggaaccttcctatgcaacagcgaacagcag
aggctggaagaggacctgccgaagaggacagtctccttgtggtcctacatcaacagtcag
catgaggagttcactaacccattgtatgtggactacgccaaccatgtactgtaccccgta
gtcagcatgcgccacctagagctctgggtcgggtactacatccgctggaacccccgcatg
aggcctcaggagccgctgcatcagcattaccgggagctgctggccaagcgggcggagctg
cagcggaaggtggaggagctccagcgggaggtggccggtcgcgtggcagtcgcccccccg
gagaaggcgggctctcccgcaggctcaccagtgcagacttgcgtgtga

DBGET integrated database retrieval system