KEGG   Paramormyrops kingsleyae: 111834002
Entry
111834002         CDS       T05788                                 

Definition
(RefSeq) uncharacterized protein LOC111834002
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pki03000]
    111834002
Transcription factors [BR:pki03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    111834002
SSDB
Motif
Pfam: PAS HLH PAS_9 PAS_4 PAS_3
Other DBs
NCBI-GeneID: 111834002
NCBI-ProteinID: XP_023648613
Ensembl: ENSPKIG00000001752
Position
Unknown
AA seq 628 aa
MIPPGDCMYAGRKRRKPVQKQKPQAGSQKSNPSKRHRDRLNAELDRLAGLLPFPPDVISK
LDKLSVLRLSVSYLRVKSFFQAIQEKAAGESDSEPARKEALLEMPTAMESEMLLESLPGF
ALVVSTDGMIFYVSPTIAKCLGFHQTDVMHQNVFDYIHLEDRRELRRQLHWAMKPSLKGG
LEPQPAAGAGEDFVVGSLFGSQDYDFIPPEFQAFLQRCFAVRMRCLLDSTSGFLAVQFQG
RLKLLQGQKRKTALGSPMPPQLALFCMVTPLQLPPIAGVKSRSAVVRSKLRSSALSVLEH
SEKRLLGAGGKVFSEETQLVNHTPWTPPSRNEGLYVSEEPLKFCRPAVDVQKALGHESVW
RAHTSPGALMLGQNCSHLTNRPGKVGHFGKAGSYQDDAQLATLYNNMQTTEQESFCSGGI
KEESGLSLQGECYGSRILQDMPIKVEPDSDSDTGCDIYGMPPGETWMSKGLSEQNCDMGY
GLSLPIKREYSCSVYTPCQTARAGTGAPCDGFYQAARGGHRPEKCPSAKVPQFSVQCFSY
PDGQARNGTGSHLYGNLSVEDRDYVELGYKSTCRSHGLLHAIKCEPADSPPWPDSHQHFG
QVFPLRNGVPDMFMNAVANKSNPYVYMQ
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgatcccgccgggagactgcatgtacgccggccgcaagcgacgcaagccggttcagaaa
cagaagccgcaagcaggaagtcagaagtccaacccgtcgaagaggcaccgcgaccggctg
aacgccgagctggatcgcctggccggcctgctgcccttcccccccgacgtcatctccaag
ctggacaagctgtccgtcctacggctcagtgtcagctacctccgggtcaagagcttcttc
caagccatccaggagaaagcggccggagagagcgactctgagccagccaggaaggaggcc
ttgctggagatgcccaccgccatggagagcgagatgttactggagtccttgcctggattc
gcgctggtggtcagcaccgacggcatgatcttctacgtctcacccaccatagcgaagtgc
ctgggcttccatcagactgacgtcatgcaccagaatgtcttcgattacatccatctggag
gaccgacgggagctgaggcggcagctgcactgggccatgaagccgtcactgaagggcggc
ctggagccgcagccggccgcgggggcaggtgaggacttcgtggtcggctccctcttcggc
tcccaggactatgacttcatcccccccgaattccaggcgttcctgcagcgctgctttgcc
gtgcggatgcggtgcctgctggacagcacctctggcttcctggcggtgcagttccagggc
cgcctgaagctcctccaggggcagaagcggaagacggccttgggctcccccatgcccccc
cagctggctctcttctgcatggtcacgcccttgcagttgcctcccattgctggggtcaag
tcccggagcgccgtggtgaggagcaaactcaggagttcagctctgtctgttctggaacac
agtgagaaaaggcttctaggtgctgggggtaaggtgttcagcgaggagacacagcttgta
aaccacaccccctggacacctccatcaaggaacgagggcctttacgtcagtgaggagccc
ttgaaattttgcagacctgctgtggatgtgcagaaagctcttggacatgagagcgtgtgg
agagcacacacatctccaggggcactgatgctgggccagaactgcagccaccttacaaac
cggcccggcaaagtgggccatttcggaaaggccgggtcctaccaggatgatgcccagctg
gccacactgtacaataacatgcagaccacagagcaggagagcttctgctcaggtggcatt
aaggaagagagcggcttgagcctgcaaggcgagtgttacggcagccgaatactgcaggac
atgcccatcaaggtggagccggactcggactcggacaccggctgtgatatctatgggatg
ccccccggtgaaacgtggatgagcaaggggctctcggagcagaactgtgatatgggctac
gggctgagccttccgatcaagagggagtatagctgcagtgtttacacaccgtgccagacg
gctagagctggcaccggtgctccgtgtgacgggttctaccaagcagcaaggggggggcac
aggccggagaagtgtccttcagcaaaagtgccccagttcagtgtgcagtgcttttcatac
ccagacggccaggccaggaatggcacggggagtcacctttacggcaacctgtcagtggaa
gacagagactacgtggagcttggctacaagtctacgtgcaggagtcacggtctgctccac
gccatcaagtgcgagcctgccgactccccgccttggcctgacagccatcagcattttggc
caagtgttcccactgcgaaatggtgtcccagatatgtttatgaatgcagtggccaacaag
tcaaacccatatgtgtacatgcaatag

DBGET integrated database retrieval system