KEGG   Paramormyrops kingsleyae: 111834017
Entry
111834017         CDS       T05788                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111834017 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pki03000]
    111834017 (mecom)
Transcription factors [BR:pki03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    111834017 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-H2C2_5 zf-C2H2_jaz zf-C2H2_6 zf-C2H2_8 zf-BED SET Zn-ribbon_8 PyrI_C
Other DBs
NCBI-GeneID: 111834017
NCBI-ProteinID: XP_023648639
Ensembl: ENSPKIG00000002043
Position
Unknown
AA seq 1218 aa
MRSKGRARKLTTSDGADFVSYADPPASLPSPSSGGATPEEHSLSRAPVCISDDLSSAQVF
ELRESQAVSSALGVWARQRLDVGECFGPYVSKQRPQRSCPTQSWKNSDESGHVKFCVDAS
GSDTRSWLQNIQFAPLAHQHNLNLCQVDDQIFYRVTRDIQAGEELLLFMKAEEYSHEVMA
PDIHVCFTLSVVTEERQYRCEDCDQNFESRTELLDHQKQPCGTPLSGFSLPNQGDASRSP
QEYRDCDQELPDMQSLETHALVSVEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECE
NCSKQVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSSVKPFICKSV
RIFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHF
ATGGLFAQGMSLQGAAVLDKAGIAGMTHGSPGLTDYFGTNRHHSSLTFPTAPSFPFSFPG
LFPSGLYHRPPLIPSTSPVKGPSGLEHPGNNPLMPSLQQCPGDRDLIKALDKESPLEPSK
VTKLQMEASSEPRCAAKLSDQSESSDLDDVSTPSGSDLETTSGSELESDLESDRERTRDN
GKVTKRKSGSPQTLPLVNNNNKDFIGNSLFPQTLDEHTAVSGAVNDSIKAIASIAEKYFG
STGLTGLQDKKVGALPYPTMFPLPFFPGFSPPLYPFPERDLHPSTVKGESQSPPAEAKKG
QSRNSDSPFDLTTKRKEEKLTPFPSSKPDVSQAASQDQPLDLSMGSRSRNGPGLTDPDSK
KSHMFGEQKAETETQKADSSLQHARPTPFFMDPIYSRVEKRKISDPFEALKEKYMRPGPG
FLFHPQFRMPDQRTWMSAIENMAEKLETFNSLKPEAGDLMRSVPSVFDFRAPPSTIPDTL
LRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHN
KEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLSGTAMSSPQSELDSSSAILDDKEDSYFT
EIRNFIGNTGQNQPSPEQSEEGMNSSQFEEEKALLPSQESHDLEEEEEQELDINEEERRH
DDAGGKSANEAFPSRLEDDVIHSETEFEEANENDLNFKAFPRRFEDDEDQSGFSALEHIR
HISNMRKIEESEFSDSDAGFMSSHLPDAIKPPLYRKSKSQAYAMMLSLADKDTLHAASHA
SSNVWHNLARAAAESSQV
NT seq 3657 nt   +upstreamnt  +downstreamnt
atgaggtccaaaggcagggcacggaaactgaccacgagtgatggagctgactttgtgtcc
tatgctgatcctcctgccagcttacccagtccatccagtggtggagccactcctgaggaa
cattccctctctcgggccccagtctgcatttctgatgacctgtcttcagcccaggtcttt
gagctgcgtgagtctcaggcagtttcctctgcccttggtgtctgggctcgccagcgattg
gatgtgggggaatgctttgggccatacgtgagcaagcagaggccgcagcgaagctgccca
acgcagagctggaagaattcggatgagtcgggccatgtgaagttctgcgtggatgccagc
ggctctgataccaggagctggctccaaaacatccagtttgctccgctggcccaccagcac
aacctgaacctgtgccaagtagatgatcagatattttatagagttacacgtgacattcaa
gctggtgaggagctgctacttttcatgaaggcagaggaatattcacacgaggtcatggca
cctgacattcatgtgtgttttacattgtctgttgtcacagaggaaaggcagtatcgttgt
gaggactgtgaccagaactttgagtccaggacagagctgctggatcaccagaaacagccg
tgtgggacgccactctctggcttctctttacccaaccagggggacgcttcccgtagccct
caggagtacagggactgtgatcaggagttgccagacatgcagagtctggagacacatgcc
ctggtcagtgtggaggaacgagaatacaaatgtgaccagtgccctaaagcctttaactgg
aaatccaatctgattcggcatcagatgtcacatgatagcggcaagcactacgagtgtgaa
aactgctcaaagcaggtgttcacagaccccagtaacctacagagacacatccgctcacag
catgtgggggcacgcgcacatgcctgccccgactgcggcaagactttcgccacatcgtcg
ggcctcaagcagcacaagcacatccacagtagtgtcaagcccttcatatgtaagtcagtc
agaatcttcatatgcgaggtgtgtcacaagtcctacacacagttctccaacctgtgccgc
cacaagcggatgcacgccgactgccggacacagatcaagtgcaaggactgcggccagatg
ttcagcaccacatcctcactcaacaagcatcgtcgtttctgtgaggggaagaaccatttt
gccacaggaggcctatttgcgcaggggatgtcactccagggtgccgccgtgctggacaaa
gcaggaattgctgggatgactcacggcagccctggattgacagactactttgggactaac
agacaccacagcagcctgacattccccacggctcccagctttccctttagcttccctggc
cttttcccctctggactataccaccgaccgccactcattcccagcacatccccagtgaag
gggccgtcaggtttggaacatccaggtaacaaccccttaatgccgtcgctgcaacaatgc
ccaggtgaccgggacctgatcaaagcgctagataaagagtcccctcttgagccatctaag
gtcacgaaactccagatggaggcatcctctgagccaaggtgtgccgctaaactgagtgac
caatcagagagcagtgacctggatgatgtcagcaccccgagtggcagtgatctggagacc
acatctggctcagaacttgagagtgacctggagagtgaccgagaaaggactcgggacaat
ggcaaagtgacaaagagaaagtctggaagcccccaaaccctgcccttagttaataacaac
aacaaggatttcatcggcaacagcctctttccacagactctggatgagcacacagctgtt
tctggtgcagtcaatgactccatcaaggccattgcttcaatcgcagagaaatactttgga
tctacggggctcactggactgcaagacaaaaaggtgggtgcattgccatacccaaccatg
ttcccccttcccttcttcccaggcttttcaccacccctctaccctttccctgagagagac
ctgcacccatccactgtaaagggagagtctcagtctcccccggccgaggccaagaaaggc
caaagcaggaactctgattcaccatttgacctcactaccaaacgcaaggaggagaaactc
actccctttccatcctcaaagcctgacgtgtcacaagcagccagtcaggaccagccgctg
gatctaagcatgggcagcaggagtcgcaatggacctggcctgacagacccagactcaaag
aagagccacatgtttggagagcagaaggcagagacggaaacacagaaagcagactcctca
ttgcaacatgctcggcccacgcccttcttcatggaccccatttacagcagggttgaaaag
aggaagatcagtgatccgtttgaggccctcaaggagaagtacatgcggccaggtcccgga
ttcctctttcacccccagtttcgtatgcccgaccagagaacatggatgtcagccatagag
aacatggcagagaaactggagacgtttaactccctcaaaccagaagccggtgacctcatg
cgttctgtcccatccgtttttgacttcagggcccccccaagtactatcccagacaccctg
ttgcgtaagggcaaggaacgctacacatgcagatactgtggaaagatattcccacgctct
gctaacctgacgcgacatctgaggacacacacaggggagcaaccatacaggtgtaaatac
tgcgaccggtccttcagcatttcatccaacctgcagcggcacatccgcaacatccacaac
aaagagaagccttttaaatgtcacctgtgtgaccgatgctttggccagcaaaccaacctg
gatcgccatctgaagaagcatgagaacgggaatctctcaggcacggccatgtcgtctccc
cagtctgagctggacagtagcagtgccatcctggatgacaaagaggactcgtacttcact
gaaatacgaaacttcattggcaacacgggccaaaaccagccatcccccgagcaatcagag
gaagggatgaacagtagtcagtttgaggaagagaaggctctgctgcccagccaggaatca
catgacctggaggaagaggaagaacaagagctggacatcaatgaagaggagaggcgacat
gatgatgccgggggcaagtctgcgaatgaagccttccccagccgcctggaagatgacgtc
attcacagcgagactgaatttgaagaagcaaatgaaaatgacctgaatttcaaggccttc
ccaaggaggtttgaggatgatgaagaccagagcgggttctcagcactggagcatattcgc
cacatttctaacatgcgcaagatagaggagagtgagttcagcgacagcgatgctggcttc
atgagcagccacctcccagatgccattaaaccgccactctacaggaaatccaagtcccag
gcatatgccatgatgctgtctctggctgacaaggacaccctccatgcagcctctcatgct
tcatccaacgtgtggcacaacctggccagggcagctgcggagtccagccaagtatga

DBGET integrated database retrieval system