KEGG   Paramormyrops kingsleyae: 111834288Help
Entry
111834288         CDS       T05788                                 

Gene name
enosf1
Definition
(RefSeq) mitochondrial enolase superfamily member 1
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00051  Fructose and mannose metabolism
pki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    111834288 (enosf1)
Enzymes [BR:pki01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     111834288 (enosf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N alpha-hel2
Motif
Other DBs
NCBI-GeneID: 111834288
NCBI-ProteinID: XP_023649170
Ensembl: ENSPKIG00000010690
Position
Unknown
AA seq 437 aa AA seqDB search
MKETIIKVTVSDVRFPTSLEQHGSDAMHNDPDYSVAYVVIETDRGSRGYGLTFTLGKGTE
IVVCAVEALSALVVGKALGDIVGDFRSFYRLLTSDGQMRWIGPEKGVIHLATAAVLNAVW
DLWAKAEGKPLWKLLVDMDPKQLVSCIDFRYITDALTEEEALDILLKGQEGRQAREEQML
SEGYPAYTTSCAWIGYTDPQLKQLCTKALNCKWTRFKVKVGADLQDDIRRCRLIRETIGP
DNTLMIDANQRWDVGEAIDWVTRLAEFKPLWIEEPTSPDDILGHATISKALAPLGIGVAT
GEQCHNRVMFKQLLQASALQFVQIDSCRLGSVNENLAVLLMACKFQVPVCPHAGGVGLCE
LVQHLILFDYISVSASLHNRMCEYVDHLHEHFKSPVLIRDACYMPPKDPGYSTEMKEESV
RKYHYPQGEVWQGLRNQ
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaccatcataaaggtgactgtcagtgatgttaggttccccacttcgctggag
cagcacggctcggatgcgatgcacaacgatccggactattcggttgcttatgtagttatc
gagacggaccggggatccaggggctatggcctgacctttacgctaggaaaaggcacagaa
atagtggtgtgtgccgtagaagccctttcggcgcttgtggtcgggaaggcgctgggagac
atagtgggcgacttccgcagcttttacaggctgctcaccagcgacggccagatgcgatgg
attggacctgagaagggggtaattcacctagctacagctgctgtcctcaacgccgtctgg
gacctctgggctaaggcagaggggaagccactttggaagctccttgtagatatggacccc
aaacagctggtatcttgcattgacttcagatatatcactgatgccctcacagaagaggag
gccttggacatccttttgaaaggccaggaggggagacaggcgagagaggagcagatgttg
agtgagggctaccctgcatacaccacgtcctgcgcctggatcggctacacagacccgcag
ctcaaacagctctgcaccaaggctctgaactgcaagtggaccaggttcaaggtcaaagtt
ggggcggatcttcaagacgacattcgtcgctgtcgtttgatcagagagacgatcggccct
gacaacaccttgatgatcgatgccaaccagagatgggatgtgggggaagccatcgactgg
gtgacgaggcttgcggaattcaagcccctgtggatcgaggaacctacctcccccgacgac
atcctggggcacgccaccatctccaaggccctggctcctctaggcatcggagtggccact
ggggagcagtgccacaaccgcgtgatgttcaagcagctgctccaggcctcggccctgcaa
ttcgtccagatcgacagctgccgtctgggcagcgtcaacgagaacctggctgtgctgcta
atggcctgcaagttccaggttcccgtctgcccccacgccgggggggtggggctttgcgag
ctcgtgcagcacctgatcctcttcgactacatatcagtgtcggccagcctccacaacagg
atgtgtgagtacgtggatcacctgcatgagcacttcaagagccccgtgctgatccgggat
gcctgctacatgcctccgaaggatccaggatactccacagaaatgaaggaagagtccgtg
aggaagtaccactacccccagggggaggtgtggcaaggccttagaaaccaataa

DBGET integrated database retrieval system