KEGG   Paramormyrops kingsleyae: 111834334Help
Entry
111834334         CDS       T05788                                 

Definition
(RefSeq) heat shock 70 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pki  Paramormyrops kingsleyae
Pathway
pki03040  Spliceosome
pki04010  MAPK signaling pathway
pki04141  Protein processing in endoplasmic reticulum
pki04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pki00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111834334
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111834334
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111834334
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111834334
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pki01009]
    111834334
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pki03041]
    111834334
   03009 Ribosome biogenesis [BR:pki03009]
    111834334
   03110 Chaperones and folding catalysts [BR:pki03110]
    111834334
   04131 Membrane trafficking [BR:pki04131]
    111834334
   03051 Proteasome [BR:pki03051]
    111834334
   03029 Mitochondrial biogenesis [BR:pki03029]
    111834334
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pki04147]
    111834334
Protein phosphatases and associated proteins [BR:pki01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     111834334
Spliceosome [BR:pki03041]
 Complex B
  Other components
   Prp19 complex
    111834334
 Complex C
   Prp19-CDC5 complex
    111834334
Ribosome biogenesis [BR:pki03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    111834334
Chaperones and folding catalysts [BR:pki03110]
 Heat shock proteins
  HSP70 / DNAK
   111834334
Membrane trafficking [BR:pki04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    111834334
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    111834334
Proteasome [BR:pki03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111834334
Mitochondrial biogenesis [BR:pki03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    111834334
Exosome [BR:pki04147]
 Exosomal proteins
  Proteins found in most exosomes
   111834334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 111834334
NCBI-ProteinID: XP_023649250
Position
Unknown
AA seq 643 aa AA seqDB search
MSSAKGLSIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPNNTIFDAKRLIGRRFDDPVVQSDMKHWPFKVISDGGKSKVEVEYKGETKAFYPEE
ISSMVLVKMKEIAEAYLGQKVSNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGKKGEHNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMV
NHFVEEFKRKYKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTSIT
RARFEEMNSDLFRGTLEPVEKALRDAKLDKSHIHDIVLVGGSTRIPKIQKLLQDFFNGRE
LNKSINPDEAVAYGAAVQAAILMGDTSENVQDLLLLDVAPLSLGIETAGGVMTALIKRNT
TIPSKQTQTFTTYADNQPGVLIQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTF
DIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIEQMVQEAERYKAADDLQREKIAA
KNSLESYAFNMKSSVEDENLKGKISEDDKKKVIDMCREAITWLENNQLAEKEEYEHQLKE
LEKVCSPIVTKLYQGGTPAGGCGSQARSTSASNSQGPTIEEVD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagccaaaggattatcaatcggcatcgacctgggcaccacctactcctgcgtg
ggagtgtttcagcatggaaaagtggaaatcattgccaacgaccagggtaacagaaccact
cccagctatgtggccttcacagacaccgaacggctcatcggagacgctgccaagaaccag
gtggccatgaaccccaataataccatctttgatgccaagcggctgatcggcagaaggttt
gacgatcctgtagtgcagtccgacatgaagcactggcccttcaaagtgatcagcgatgga
ggaaagtccaaagttgaggttgagtacaaaggagagaccaaggcattctacccagaagaa
atctcctccatggtcctggtgaaaatgaaggagattgcagaagcttacctggggcagaaa
gtgtcaaatgctgtcatcactgtccccgcctacttcaatgactcccagcgccaagccacc
aaggatgcaggagtgattgctgggctgaacgtgttgaggatcatcaacgagcccacagcg
gctgccatcgcctacggcctagataaaggcaagaagggggagcacaatgtcctgatcttt
gacctgggtgggggcacctttgacgtgtccatcctgaccatcgaggatggcatctttgag
gtgaaggccacagcgggagacacccatctgggtggtgaggactttgacaatcgcatggtc
aatcactttgtggaggagttcaagaggaaatacaagaaggatatcagtcagaacaaaagg
gcactgaggaggctgcgcacagcatgtgagagggccaagagaaccttgtcctccagctcc
caggccagtattgagattgattctctgtttgaaggcattgacttctacacatcaatcacc
agggcacgcttcgaggaaatgaattctgacctcttcagaggaacactggaacctgtggaa
aaagccctgagagatgccaaactggacaagtcgcacatccatgacatagtgttggtggga
ggctccactcgaattcccaagatccagaaactgctgcaagatttcttcaacggcagagag
ctgaacaagagcatcaatccagacgaggcagtggcctacggtgcagctgttcaggcagcc
atcctaatgggtgatacctctgagaatgttcaagacttacttctgctggatgtggctcca
ttgtctctgggcatcgagacggcaggaggagtcatgactgctcttatcaaacgtaacact
accattcccagcaaacagacgcagactttcaccacctatgctgacaaccagccaggggtc
ttgatccaggtgtatgagggagaacgagccatgactaaggacaacaacctgctgggcaag
tttgatctcactggcatccctccggccccacggggggtcccccagatcgaggtgaccttc
gacattgatgccaatggcattctgaatgtgtcagcagttgacaagagcactggaaaggag
aacaagatcaccatcaccaatgacaagggtcgtctgagcaaggaggatatagagcagatg
gtgcaagaggcagagaggtacaaagctgcggacgaccttcagagagagaaaatcgctgcc
aagaactctctggaatcatacgccttcaacatgaagagcagtgtggaagatgagaacctg
aaaggcaagattagtgaggatgacaagaaaaaggtcattgacatgtgcagggaggccatc
acttggctggagaacaatcagctggctgagaaggaggaatatgaacatcagctgaaggag
ctggagaaagtgtgcagccccattgtcaccaagctgtaccagggagggacaccagctggg
ggctgtggcagtcaggctcggtcaacttccgcgtccaactctcagggcccaaccattgaa
gaggtggattaa

DBGET integrated database retrieval system