KEGG   Paramormyrops kingsleyae: 111834390Help
Entry
111834390         CDS       T05788                                 

Gene name
nmnat1
Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00760  Nicotinate and nicotinamide metabolism
pki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    111834390 (nmnat1)
Enzymes [BR:pki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     111834390 (nmnat1)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     111834390 (nmnat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 111834390
NCBI-ProteinID: XP_023649408
Ensembl: ENSPKIG00000013743
Position
Unknown
AA seq 285 aa AA seqDB search
MDCAKKTKLVLLSCGSYNPVTNMHLRMFELAREHLQIKGHYEVVKGIISPVGDGYNEKGL
IEASHRVEMAKLAVESSSWIEVDSWEGRQADWQETNKVLRHHWEELLSREQGTDVVGTVK
AGRKRKRIDAVSISNKRKHGKMEVAHKGLMHKTDGPHLMLLCGADVLESFGVPGLWKNED
IEEIVGSYGLVCITRSSFDVDAFIQGSDLLWPHRHNIHVVREWVANDVSATHVRRALRRG
HSVRYLLPDPVLSYIQERRLYTAESEQTNAGVVLAPLQKHAGNHG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggattgtgccaagaaaaccaaactggtgctgctgtcttgtggctcctacaacccagtc
acaaacatgcacttgcgcatgtttgaactggcacgtgagcacctgcagatcaaaggacat
tatgaagttgttaaggggatcatatcaccagtgggcgatggctacaacgagaagggcctg
atcgaggccagccatcgggtggaaatggccaagctggcggtagagagctccagctggatc
gaggtggacagctgggagggcaggcaggccgactggcaggagacaaacaaagtcctacgg
catcactgggaggagctgctctccagggagcagggcactgatgtggtgggcacagtgaag
gctggcaggaagagaaaacgcatagatgctgtcagtatcagcaataaaaggaagcacggg
aagatggaggttgcacacaagggcctgatgcacaaaacagatgggcctcatctgatgctg
ttgtgtggtgctgatgtgctggagtcctttggggtaccggggctgtggaagaacgaggac
atcgaggagatcgtgggcagctacggactggtgtgcatcacccgcagcagcttcgacgta
gacgccttcattcagggctccgacctcctctggccacaccgccacaacatccatgtggtg
cgcgagtgggtggccaacgacgtgtcggccacgcacgtccgccgcgcgctgcggcgtggc
cacagtgtccggtacctgctgcccgacccggtgctcagctacatccaggagcggcggctc
tacaccgctgagagtgagcagacgaacgctggtgttgtattggctccactgcagaaacac
gcagggaaccatggctga

DBGET integrated database retrieval system