KEGG   Paramormyrops kingsleyae: 111834701
Entry
111834701         CDS       T05788                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) B-like isoform X1
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111834701
Enzymes [BR:pki01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     111834701
SSDB
Motif
Pfam: AstE_AspA RRM_1
Other DBs
NCBI-GeneID: 111834701
NCBI-ProteinID: XP_023650043
Ensembl: ENSPKIG00000004376
Position
Unknown
AA seq 382 aa
MVQSWRRARLDVTVASTRSMWSKNPATWLKVIHRFPSLASVSLQELSMVTVADQEEERRS
SHLIYKMEVVSLPAVSRVAICGGTHGNEMTGVFLVKELQKRKRKEEGAEAPDILPVISNP
RAVQRCQRYIETDLNRCFTTATLSVPVSDGTPYEIQRAQELNVFLGPKGSVKSVDLVCDL
HNTTANMGLCLISYSECDWISLHICRHLQKEMPSVPVRYIHYDVPLSEAYSLESVGKHGF
AMEVGPQPHGVVRADVWGTMTEGVRLVLDWIKRFNSGVQFDDKVMEIYTLVKTIDYPRDP
ETQMITATIHPQLQDHDFCLLHQGDPLFLTFSGNTEYYRGEEPLYPFFVNESAYYEKGIA
FLLARKKKVNIPSVRVMTRESV
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggtgcagagctggcgacgtgcccgacttgatgtgaccgttgcatccacacgaagcatg
tggtctaaaaatcccgcaacatggttgaaagttattcatcgatttccgtctcttgcatcg
gtgagtcttcaggagttatctatggtcaccgtagcagatcaggaagaggaaaggagatcc
agtcacctcatttacaagatggaggtggtcagtctgccggctgtgtcccgcgtggcgatc
tgcggcggcacccacggcaacgagatgacgggcgtgttcctggtgaaggaactgcagaag
aggaagaggaaggaggaaggggcagaggctcccgacatcctcccggtgatatccaacccg
cgagctgtccagcggtgtcagcgatatatagagacagacctcaaccgctgcttcactact
gccaccctcagtgttccagtgtcagacgggaccccgtatgagattcagcgagcgcaggag
ctgaacgttttcctgggccctaagggcagcgttaagtctgtggacctggtgtgcgacctg
cacaacaccactgccaacatgggcctgtgtctcatctcgtactccgaatgcgactggatc
tctctgcacatctgtagacacctgcagaaggaaatgccgtccgtccctgtgaggtatatc
cactatgatgttcctctctctgaagcctattctctggagtcagtgggcaagcatggcttt
gctatggaggttggtccacagccccatggggtcgtcagggcagacgtctggggcaccatg
acggagggggtccgccttgtactggactggatcaagcgctttaactcaggtgtccagttt
gatgacaaagtgatggaaatctacaccttggtgaagaccattgattaccccagagatcca
gagacccagatgatcacagcaacgatccacccccaactccaggaccacgacttttgcctg
cttcaccaaggcgatcccttgttcctgacattctcgggaaacacagagtattacagaggc
gaggaacctctatatcctttcttcgtaaacgagtctgcatactatgagaaaggaattgct
ttcttactagcccggaagaaaaaagtgaacattccatctgttcgggtgatgacaagggaa
agcgtgtga

DBGET integrated database retrieval system