KEGG   Paramormyrops kingsleyae: 111834775Help
Entry
111834775         CDS       T05788                                 

Gene name
gpx7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00480  Glutathione metabolism
pki00590  Arachidonic acid metabolism
pki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111834775 (gpx7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111834775 (gpx7)
Enzymes [BR:pki01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     111834775 (gpx7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin PepSY
Motif
Other DBs
NCBI-GeneID: 111834775
NCBI-ProteinID: XP_023650199
Ensembl: ENSPKIG00000011422
Position
Unknown
AA seq 185 aa AA seqDB search
MRFALIMVMLLLANFAEGKQKDFYTFKVVNSRGKLVSLEKYRGSVSLVVNVASECGYTED
HYTDLQQLQRDFGPYHFNVLAFPCNQFGQQEQGSDKEIDSFVRRVYGVSFPLFSKIAVVG
SGANNAYKYLVESSGKEPNWNFWKYLIDVNGKVVNTWGPTTSVKEIRPLISDMVRQIILK
KKVEL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcgcattgataatggtgatgcttctcctcgccaattttgctgagggtaaacag
aaggatttttacacttttaaggtggtgaatagcagagggaagctggtgtctttggagaaa
taccgggggtcggtatcgctggtggtgaacgtggccagcgagtgcggctacaccgaggat
cattacactgacctccagcagctccagcgagactttgggccctaccacttcaacgtgctg
gccttcccctgcaaccagtttggccaacaggagcaaggcagcgacaaggagatcgacagc
ttcgtgcggcgtgtttatggtgtcagtttccccctcttcagcaagatcgccgtggtggga
agtggggccaacaacgcttacaaatatctggttgagtcttccggaaaggagccgaattgg
aatttctggaagtacctgatcgacgtgaatgggaaagtggtaaatacgtgggggcccacc
acctctgtgaaagagatccgtccactgatctcagacatggtgcgacagatcatcctgaag
aagaaagtggagctttag

DBGET integrated database retrieval system