KEGG   Paramormyrops kingsleyae: 111834941Help
Entry
111834941         CDS       T05788                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial-like isoform X1
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00071  Fatty acid degradation
pki01212  Fatty acid metabolism
pki03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111834941
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    111834941
Enzymes [BR:pki01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     111834941
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 111834941
NCBI-ProteinID: XP_023650568
Ensembl: ENSPKIG00000011296
Position
Unknown
AA seq 671 aa AA seqDB search
MASLLSLQLPLAVRRSGCFTSLTSTFASPLLCSRRNYLKNDWPESEYLHKSIVPTMHYQK
SLPRLPIPKLEDTIRRYLAAQRPLLNKEQYRNTEKVALDFQKGVGKELHEELVALDKKNK
HTSYISAPWFDMYLSARDSIVLNFNPFISFTADPKPEYNDQLVRATNMVCSALRFMKTLR
AVCLEPEVFHLNPAKSDTETFKKFIRWVPPTFSWYGAYMVNAYPLDMSQYFRLFNSTRIP
RPGRDELFTDQKGRHLLVIRKGNMYVFDVVDRDGNLVRPTEIHAHLSFILSDPTPPPAFP
LGFLTSENRDVWAGLREKLLAAGNAEVLRLVDSAVFCVCLDEESMRDPVHISHNMLYGDG
GNRWFDKSFSIIFSKDGHAAVNFEHSWGDGVAVLRFLNEVFKDTTEKPQVSPGSPPAAMD
SASAVTHLQFKLDSELERAVGKAWKKYQEAVSKVTIETMEFRKGGKEALKKKKLSPDAIA
QLAFQMGFLRQYGQTVATYESCSTAAFRHGRTETIRSATVHTKRCAHAFIREGSQHSLDE
LRGLLDECSKYHGQLTKEAAMGQGFDRHLFAMRYLVTSKGLPLPSLYQDPAYAAINHNIL
STSTLTSPAVTLGGFAPVVPDGFGVGYGVHDDWIGSNVSSYPARNVREFLQCVHESLEDI
FGVLDGKLPQS
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggcctctctgctttccctgcaattgcctttagctgttagacgatcgggatgttttact
tctttgaccagtacttttgcgtcccctttgctgtgcagcagacggaactacttgaaaaat
gactggcctgaatcggagtacctgcacaaaagcattgtgccaacgatgcactatcagaag
agtttgccacggttgcctattccaaagctggaagacactattaggcgctatttggctgct
caaaggccgcttttaaacaaagaacaataccgtaacactgagaaggtggctctggacttc
cagaagggtgtggggaaagagctccatgaggagttagtggctctggacaagaagaacaag
cacaccagttatatctcggctccctggtttgatatgtacctctcagcacgggactccata
gtgttgaacttcaaccccttcatatctttcactgcggatcccaagccagagtacaatgac
cagctggtacgggcgaccaacatggtgtgttcggccttgcgtttcatgaagaccctgcgc
gccgtgtgcttggagcctgaggtgttccacctgaaccctgctaagagtgacacagagacc
ttcaagaagttcattcgctgggttccccccacgttctcctggtatggggcctacatggtg
aatgcttaccccctggacatgtctcagtacttccgtctgttcaactccacacgcattccc
agacccggacgtgacgagctctttactgaccagaaggggcgacacctgctggtgattcga
aaaggcaacatgtatgtgttcgacgtcgtcgacagagatgggaaccttgtgaggccaacg
gagattcatgcccacctcagcttcatcctgtctgacccgacgccaccaccagcattcccg
ctgggcttcctgaccagtgagaacagggatgtctgggcaggcctgcgggagaagctgttg
gctgctgggaatgcggaggtgctcaggctggtagacagcgccgtcttctgcgtctgtctg
gacgaggagagcatgcgcgaccccgtccacatctcccacaacatgctgtacggcgacggg
ggcaaccgctggttcgacaagtcattcagcatcatattctccaaagacggacatgctgct
gtgaacttcgagcactcatggggtgatggcgtcgctgttctccgattcctcaacgaggtc
ttcaaggacacgaccgagaagccccaggtgagcccagggtctccgccggctgccatggac
tctgcctccgcggtgacccatctgcagttcaagctggacagcgagctagagagggccgtc
ggcaaagcctggaaaaaataccaggaggctgtttccaaggtgacgattgagaccatggag
ttccggaagggcggcaaggaggcgctgaagaagaagaagctgagcccagatgccatagcg
cagctggccttccagatgggcttcctgcggcagtacggccagacggtggccacctacgag
tcctgcagcacggccgcgttccggcacgggcgcacagagaccatccgttcggccaccgtc
catacaaagcgctgcgcccatgcctttatccgggagggcagccaacactctctggatgag
ctacggggcttgctggatgagtgctccaagtaccacgggcagctgaccaaggaggcagcc
atggggcagggatttgaccgacacctgttcgccatgcgatacctggtcacctccaagggc
cttcccctgcctagcctgtaccaggacccagcttacgctgccatcaaccataacatcctc
tccaccagcaccctcaccagccctgctgtcacactgggtggcttcgcacctgtggtgccc
gacggcttcggcgtgggttatggtgtccacgacgactggatcggctccaacgtctccagc
tacccagcccggaacgtcagagaattcctgcagtgtgtccatgaatccttggaagacatc
ttcggtgtcttagatggcaagcttccccaaagctag

DBGET integrated database retrieval system