KEGG   Paramormyrops kingsleyae: 111835145
Entry
111835145         CDS       T05788                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00100  Steroid biosynthesis
pki01100  Metabolic pathways
Module
pki_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    111835145 (tm7sf2)
Enzymes [BR:pki01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     111835145 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 111835145
NCBI-ProteinID: XP_023650903
Ensembl: ENSPKIG00000023028
Position
Unknown
AA seq 421 aa
MKPDKRRCASSKDREFGGTLGATCIPVFLPLTVLYLLSVSRTPGAALLQWPPPLPPASQL
WDPVAAALVLGWLTLQIVLYLLPVGKVAEGMVLRDGTKLRYPINGFHALCISAALLALSV
WLGMPLGYLFELLMPLATCAMGLSFLLSLYLYIRSFWAPKHALAVGGNTGNPLYDFFMGR
ELNPRIGSFDLKYFCELRPGLIGWVVINLGMLMKEVELRDSPSLAMLLVNGFQLLYVADA
LWNEEALLTTMDIVHDGFGFMLAFGDLTWVPFTYSLQANFLVVHPQPLGPVGAAAIVLLN
GMGYFIFRQSNSQKNQFRRDPTHPSVAGLETIPTATGKRLLVSGWWGLVRHPNYLGDLLM
ATAWSLPCGASHTLPYFYVLYFTVLLIHREARDERQCRSKYGLAWDTYCRRVPYRIVPYI
Y
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgaagccggacaaacgcagatgcgcatcctcgaaggacagggaattcggtgggacctta
ggcgccacctgtatccccgtcttcctgccgctgaccgtgctttacctgctgtccgtcagc
cgcacccccggtgctgccctgctccagtggccccctcccctgcctcccgcctcccagctg
tgggaccccgtggctgctgctctagtgctggggtggttgaccctgcagatcgtcctctat
ctgctccccgtgggaaaggttgctgaaggaatggtgctcagagatgggaccaaactcaga
tatcctatcaatggttttcacgcactgtgcatcagcgccgccctgctggccttgtctgtg
tggttaggcatgcctttggggtatctgtttgagctgttgatgcctctagcaacatgtgca
atgggcctgtcattcctgctctccctgtatctctacatacgttcattctgggcgcccaaa
catgccctggctgtagggggcaatacaggtaaccctctctacgacttttttatgggacgt
gagctgaacccacgaatcggaagctttgacctcaagtatttctgtgagcttcggcctggt
ctcattgggtgggttgtcataaacctgggtatgctaatgaaggaggtggagctacgagac
tccccttcccttgccatgctattggtcaatggcttccagttgctttacgtggccgacgcc
ctgtggaatgaggaggccctgctgaccaccatggacatcgtgcacgacggctttggcttc
atgctggccttcggggacctgacctgggttccgtttacctacagcctgcaggctaacttc
ctggtggtgcaccctcagccgctgggccccgtcggcgccgccgccatcgtcttgctgaac
ggcatggggtattttatctttcgccagtccaactcacagaagaaccagtttcgacgggac
cccactcatcccagcgtagcaggtttggagacgattcccacggcaacggggaagcgcctt
ctagtgtctggttggtgggggcttgtccgacaccccaattacctgggagacctgctcatg
gccacagcctggtccctcccctgtggcgcctcacacactctcccttacttctacgttctg
tacttcaccgtcctgctcatccaccgggaggctcgggacgagaggcaatgcaggagcaag
tacggcctggcctgggacacctactgccgcagagtgccctacaggatcgtcccttacatc
tactga

DBGET integrated database retrieval system