KEGG   Paramormyrops kingsleyae: 111835201Help
Entry
111835201         CDS       T05788                                 

Definition
(RefSeq) transforming growth factor beta-2-like isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04010  MAPK signaling pathway
pki04060  Cytokine-cytokine receptor interaction
pki04068  FoxO signaling pathway
pki04110  Cell cycle
pki04218  Cellular senescence
pki04350  TGF-beta signaling pathway
pki04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111835201
   04350 TGF-beta signaling pathway
    111835201
   04068 FoxO signaling pathway
    111835201
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111835201
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111835201
   04218 Cellular senescence
    111835201
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111835201
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pki04052]
    111835201
   00536 Glycosaminoglycan binding proteins [BR:pki00536]
    111835201
Cytokines and growth factors [BR:pki04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   111835201
Glycosaminoglycan binding proteins [BR:pki00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   111835201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 111835201
NCBI-ProteinID: XP_023651008
Ensembl: ENSPKIG00000025268
Position
Unknown
AA seq 418 aa AA seqDB search
MTSCSLRTILLAYPILILLAMAICAQGFSTCQSFDLDDYKSKRIEAVRGQILSKLRIREP
PEREVSPPPEEVPQEVMLLYNSTKEFAKVDPSCERESSEEDYYAKEVQRVDMLPPRIDTN
VINGGPPSLYFRVVRFDVSRVDRNSSTLVKAEFRIYRIPNPQARTLEQRVEIYQLLKSRD
PAAPSQRYIESRTVRPRAKGSWLSVDVTDTVKEWLANKDRNLGLKLSVHCPCCTFVPSTN
NIVPNRSEELEARFAGIDDEIMKLHKRPEAVKGQIEFSTKTPHLILSLLPSDRLDDSSKK
HRKRRAAADVPTCSRSMDQGCCLRSLYIDFRRDLNWKWIHEPKGYKANFCAGNCPYLWSA
DNHYSMILPLYNKLNPEASVSPCCVPQDMEPLTIVYFVGRTPRVEQLSNMVVKSCKCR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacctcctgcagcttacgaacgattctacttgcatacccgattctgattttactcgct
atggcaatctgtgcacaaggcttttccacctgccagtctttcgacttggacgactacaag
tcgaagaggatagaggccgtgcgcggacagatccttagcaagcttcgcattcgggagcca
cctgaacgtgaagttagcccaccacccgaggaggtccctcaggaagtcatgcttctttac
aacagcaccaaggagtttgccaaggttgatccttcctgtgaacgcgagagcagtgaggaa
gactactacgccaaagaggtccagcgagtcgatatgctaccacctcgcattgacacaaat
gtgatcaatggtggacctccgagcttgtatttccgggttgtaaggtttgatgtcagtcgc
gtggacagaaactccagcacgctggtgaaagcagaattcaggatatatcgcatccccaac
ccacaggctcgcaccttggagcagagggtggaaatatatcagctactgaaatctcgcgac
ccagcagctccctcgcagcgatacatcgagtcccgcacggtgcgtccccgcgccaagggc
tcgtggctgtctgtcgacgtcacagacaccgtcaaggaatggctagcaaacaaagacaga
aacttgggactgaagctgagcgtgcactgtccgtgttgtacgtttgtcccctccactaac
aacatcgtgcccaatagaagcgaagagctggaggcccgtttcgcaggtattgacgatgaa
ataatgaagctgcacaagaggccagaagctgttaagggccaaattgagttcagcaccaag
acaccacacctgattcttagcctgctgcccagtgacaggctggacgattctagcaagaag
caccgcaagcggagggcagcagccgacgtccccacatgctcacgcagcatggaccaagga
tgctgtctccggtccttgtacattgatttccgccgtgacctgaactggaagtggattcat
gagcctaaaggctacaaggccaacttctgtgctgggaactgtccgtacttatggagtgca
gacaatcactacagtatgatcctgcccctgtacaacaagctgaatcccgaggcctccgtc
tccccgtgctgcgtccctcaggacatggagcccctcaccattgtgtactttgttggtcgc
acaccacgcgtcgagcagctctcaaacatggttgtcaaatcttgcaagtgccgctga

DBGET integrated database retrieval system