KEGG   Paramormyrops kingsleyae: 111835725Help
Entry
111835725         CDS       T05788                                 

Gene name
nln
Definition
(RefSeq) neurolysin, mitochondrial isoform X1
  KO
K01393  neurolysin [EC:3.4.24.16]
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pki01002]
    111835725 (nln)
Enzymes [BR:pki01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.16  neurolysin
     111835725 (nln)
Peptidases and inhibitors [BR:pki01002]
 Metallo peptidases
  Family M3
   111835725 (nln)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M3 Citrate_synt
Motif
Other DBs
NCBI-GeneID: 111835725
NCBI-ProteinID: XP_023652096
Ensembl: ENSPKIG00000025551
Position
Unknown
AA seq 788 aa AA seqDB search
MAQQCLLRKTSSGPNDAVMRALADPAPRACALPQEVDRLDTRPRLSSRARARTGILRRAC
SLCGMHRFRCILHCRAVCRGFPARPQLRMTLQDRPVASVPDRFLSTHGQNELRWDLMPDQ
IKCKTDKLIQKITQMYDNVGALDPDEVSFENTLKALADAKMEYAAFRHILDFPQYVSPCR
EVRHASTEADRKLSDFDVELSMREDIFQRVLALQSKQPDLKSEAKRFMERLVRLGRRNGL
HLSKDVQEEIKSTLKLISKLCIDFNKNLNEDDTHLLFTVDELGGMADSYIKGLERMEDGR
FRVTLKYPHYFPLMKRCHVQETRRRMETAFHSRCKEVNTAILEQLIPLRARVARLLGFSS
HANYVLAVNMAQNSATVARFLDEFHAALKLAGKQELRYILELKRRECEEMGRTFDGQIHA
WDMPYYMNQVEQVKFAVDKDKLIEYFPLEMVTQGLLSIYQDLLGLTFWQVPNAHVWHDTV
SLYSVQDTASGEEIGQFYLDLHPSDEPDWAGFRLAPMVLSSREGKYGHAACFGLQPGGLG
PDGRRRRPVAAMVANFTKPMASWPSLLQHHEVETFFHEFGHVMHEICSRTDYVEFSGTLV
ETDFVEVPSQMLENWVWEKEPLQRMTQHYKDGSPIPDSLLDKLIASRVANMGLMNLRQVV
LSKVDQALHTKPSADTAEEFARHCRDILGIPATPGTNMTASFSHLAGGYDGQYYSYLWSE
VFSMDIFFSRFKKEGVMNPKVGMEYRKVILEAGGSVDGADMLKAFLGREPSQEAFFQCKG
LPQLGESG
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcaatgtctgctgagaaaaacctccagcggtcccaacgacgcagtcatgcga
gctcttgcagacccagctccccgcgcatgcgcactaccgcaggaagtggatcggctggat
actcggccgcggctgtcaagtcgagcgcgggcgcggactgggattctgcggcgcgcatgt
tccttgtgcggcatgcatcgttttcgctgtatacttcactgtcgagccgtttgcagaggc
tttcctgctagaccgcaattgaggatgacccttcaggacaggcctgtggcgtccgttccg
gatcgcttcctgtctactcatgggcagaatgaactgcggtgggaccttatgcctgaccag
attaaatgcaaaacagacaagctgatccagaaaatcacacagatgtatgacaacgtgggt
gcactggacccagatgaggtgtctttcgaaaataccttaaaggccttggctgatgccaag
atggaatatgcagctttcaggcacatcctggatttcccccagtatgtctcgccgtgccgg
gaagtgcgtcacgccagcacggaggcagacaggaagctgtctgactttgacgtggagctg
agcatgagggaggacatcttccagagggtcctcgctttgcagagtaagcagcctgatctg
aaatccgaggccaagagattcatggagaggcttgtccggctggggaggcgaaacggactg
catctctccaaggatgtgcaggaggagattaaatccaccctcaagctgatcagcaagctt
tgcatagatttcaacaagaacctgaacgaggacgacactcacctgctcttcaccgtggac
gagctaggcggcatggcggacagctacataaagggcctggagcgcatggaggacggtcgc
ttcagggtgacgctgaagtacccccattacttcccgctcatgaagaggtgccacgtccag
gagacccggcggaggatggagaccgccttccacagccgctgtaaagaggtgaacacagcc
atcttggagcagctgatccctctgcgggccagagtggcgaggttgctgggcttcagctca
catgccaactacgtgctcgcggtgaacatggcccagaatagtgccaccgtcgcccgcttt
cttgatgaattccacgcggcgctgaaactggcaggcaagcaggagctgcgctacatcctg
gagctgaagaggcgggagtgcgaggagatgggccggacgttcgatgggcagatccatgcc
tgggacatgccctactacatgaaccaggtggagcaggtcaagttcgctgtagacaaggac
aagctgattgagtacttccctctggagatggtgacacaggggctcctgagcatctaccag
gacctgctgggcctcaccttttggcaggtgcccaatgcccacgtatggcatgacacagtc
agcctgtactccgtgcaggacaccgcctccggggaagagataggacagttctacttggac
ctgcatcccagtgatgagccggactgggccggattcagactggcgcccatggtgctttct
tccagggaggggaagtacgggcacgcagcctgctttgggctgcagccgggcggcttgggc
cccgacggacggcgcaggcggccggtggcagccatggtggccaacttcacaaagcccatg
gccagctggccctcgctgctgcagcaccacgaagtggagaccttctttcacgagtttggc
cacgtcatgcatgagatctgctccaggacggactatgtggagttcagtgggacgcttgtt
gagacggactttgtggaggtaccttcccagatgctggagaactgggtgtgggagaaagag
cccctgcagagaatgacccaacactacaaggacggcagccccatcccagacagcctgtta
gacaaactcatcgcctcccgcgtggccaacatggggctcatgaatctgcgtcaggtggtc
ctcagcaaagtggaccaggctctccacacgaagcctagtgctgacacggcagaagaattc
gccaggcactgcagagacatcctggggattccagcaactccaggcacaaacatgactgcc
agctttagtcatttggctgggggttatgatgggcagtactacagctacctgtggagtgag
gtcttctccatggacatctttttcagccgcttcaagaaggaaggagtcatgaatccaaag
gtagggatggaatataggaaggtgatcctggaagctggcggctcagttgacggtgctgac
atgctgaaggctttcctgggccgtgagcctagtcaggaagccttcttccagtgcaagggt
ctgccccagctgggggaatcaggctga

DBGET integrated database retrieval system