KEGG   Paramormyrops kingsleyae: 111835826Help
Entry
111835826         CDS       T05788                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
pki  Paramormyrops kingsleyae
Pathway
pki03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pki00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    111835826
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pki03012]
    111835826
Translation factors [BR:pki03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    111835826
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI ParcG DUF2779
Motif
Other DBs
NCBI-GeneID: 111835826
NCBI-ProteinID: XP_023652291
Ensembl: ENSPKIG00000002049
Position
Unknown
AA seq 925 aa AA seqDB search
MSRFFATGSDSETEESSSGEEVIAKTTGTTFTKQSLLLSDDEEDTKRVVRSAKDKRFEEL
TNLIKTIRNAMKIRDMSKCLEEFEQLCRAFVKSKNIVDKEGVPKFYIRLLADLEDYLNQL
WEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFENEIANYKENPEQSPDEEEEKDEWPSGS
SSESDDDEDKGEKAAKNRSSFLKKKPSSEPLPDAKKFLKGAVDEESESEDEEDDEDWSSD
TAESGSESEDDEGKNASLAAVFLKKTQEPDKQAAGKKKRRPKKTGQQDEEGEEEQGDEEE
SGWKKVKGGVPLVKPRMFPKGTEINTGVVVKKLNEILQARGKKGTDRAAQIELFHALAGI
ANENNLGEGILVKIKFNIIASLYDYNPNLAAFMKPEMWKNCLDCIDELLNILFDNSNIFI
GENIAEDSENLAVSDQPFRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVDNLKDEGRVC
GIIDRLLQYLENKGSTEEVCRVYLRRIMHTYYKFDYKAHRRSLGLQGESKSEQDQEESEG
EDSAVVMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHA
DPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAE
QEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVG
ERQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPESQRVREMLVR
KIQEESLRTYLFTYSSVYDSISMETLSEMFELELPTVHSIISKMIINEELMASLDQPTQT
VVMHRTEPTSLQNMALQLAEKLGGLVENNERVFDLKQGVYGGYFNRDQKGGYQQKQGYQR
DQKGGYQQKQGYQRGGYRNQAQSSY
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtttctttgcgactggatctgacagtgagacggaggagtcctcatctggggaa
gaggtcattgccaaaaccactgggaccaccttcactaaacagtctctgctgctaagcgac
gatgaagaggacaccaagagggtggtgcgcagtgccaaggacaagaggttcgaggagctt
acaaacctgatcaaaactatcagaaatgccatgaagattcgggacatgtcaaagtgcttg
gaggagtttgagcagctatgtcgggccttcgttaagagcaagaatattgtggacaaggag
ggtgttcccaagttctacatccggcttctggctgaccttgaggattacctgaatcagttg
tgggaggataaagaagggaagaagaagatgaacaagaacaacgccaaggccttgagcacc
ctgcgacagaaaatccgcaaatacaaccgtgactttgaaaatgaaattgccaactacaag
gagaatccagagcagtctccagacgaggaggaggagaaggatgagtggccttcaggttcg
tcttcagagagcgacgacgacgaggacaaaggggagaaggcagcaaagaacagaagctca
ttcttgaaaaagaaacccagcagtgagccccttcctgatgccaagaagttcctcaaggga
gctgtggatgaagagtcagagagtgaagatgaagaagatgatgaagactggagttcagac
acagcagaaagtggcagtgagagtgaagatgacgaaggaaagaatgcctccctcgctgcg
gttttcctcaaaaagactcaggagcctgacaaacaagccgcaggaaagaagaaaaggaga
ccaaagaaaactgggcagcaagatgaggagggtgaagaggagcaaggtgatgaagaagag
agtggttggaagaaggttaaaggcggcgtgcccctggtcaagccaaggatgtttcccaag
ggcactgagatcaacactggtgttgttgtcaagaagttgaatgagatccttcaggctcgt
ggcaagaagggaactgatagagctgcccagattgagctcttccatgctcttgctggaatt
gccaatgaaaacaacttaggagagggaattctggtcaagatcaaattcaacatcatcgcc
tcactctacgactataaccccaacttggctgcttttatgaagcctgagatgtggaagaat
tgtctggattgcatcgatgaactgcttaatattttgtttgacaacagtaacattttcatt
ggagaaaatatcgcagaggacagtgaaaatctcgccgtctctgatcagccgttccgggtc
cgaggatgcattctcactctggttgaaaggatggatgaggagttcaccaaaatcatgcag
aacactgacccacactcacaggagtacgtggacaacctgaaagatgagggccgcgtgtgc
gggatcatcgaccgcttgctgcagtacctggagaacaagggcagcacagaagaagtatgc
cgggtctacctacgcaggatcatgcacacctactacaaatttgactacaaggcccatcga
cgcagcctgggcctgcagggggagtccaagtctgagcaagaccaagaggagagtgagggg
gaggacagcgcagtggtgatggaccgactctgcaagttcatctacgcgaaggaccgcacc
gaccgcatccgcacctgcgccatcctctgccacatctatcaccacgcgctacacagccgc
tggtaccaggcccgcgacctcatgctcatgagccacctgcaggacaatatccagcatgcc
gacccaccagtacagatcctgtacaaccgcaccatggtgcagctgggcatctgtgccttc
agacagggtatgatcaaggacgcccacaatgcccttttggacatccaatcgagtggccgt
gccaaggagctgcttggacagggtctgctgatgaggaacatgcaggagaggaatgcggag
caggagaagattgagaagaggcgtcaggtccccttccacatgcacattaacctggagctg
ctggagtgtgtatacctggtgtctgctatgctgctggagatcccctacatggctgctcac
gagtttgacgcccgtcgcaggatgattagcaagcagtttcaccaccagcttagggtcggc
gagaggcagcctctgctgggtccccctgagagcatgcgggagcacgtggtggcggccagc
aaggccatgaagatgggcgactggcgcacatgtcactcattcatcatcaacgagaaaatg
aacagcaaagtgtgggacctgtttcctgaaagccagagagtccgggagatgctcgtccgg
aagatccaagaggaatctctgcgtacctacctgttcacctacagtagtgtgtatgactcc
atcagcatggagaccctctctgagatgtttgagctggagttgcccacagttcacagcatc
atcagcaagatgatcattaacgaggagctcatggcatccctggaccagcccactcagact
gtcgtgatgcaccgcacagagcccacatccctgcagaacatggccctgcagctggctgag
aaactcggtgggcttgtggagaacaatgagagggtcttcgatctgaaacagggcgtttat
gggggctacttcaacagggaccagaaaggtggttaccagcaaaagcagggctatcagaga
gaccagaaaggcgggtaccaacagaaacaaggataccagagaggtggctacaggaatcag
gctcaaagctcatattga

DBGET integrated database retrieval system