KEGG   Paramormyrops kingsleyae: 111836089Help
Entry
111836089         CDS       T05788                                 

Gene name
camk4
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV isoform X1
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04020  Calcium signaling pathway
pki04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111836089 (camk4)
   04020 Calcium signaling pathway
    111836089 (camk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pki01001]
    111836089 (camk4)
Enzymes [BR:pki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     111836089 (camk4)
Protein kinases [BR:pki01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   111836089 (camk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 Kdo YrbL-PhoP_reg APH
Motif
Other DBs
NCBI-GeneID: 111836089
NCBI-ProteinID: XP_023652821
Ensembl: ENSPKIG00000025590
Position
Unknown
AA seq 365 aa AA seqDB search
MLKVTMPSSSSGAASEYWIDGSKKETLADYYELQSELGRGATSVVFRCRQKGTQKPYAVK
MLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPAEISLVLELVTGGELFDRIVEKGY
YSERDAADAVKQILEAVAYLHENGVVHRDLKPENLLYATSAPDAPLKIADFGLSKIVDDQ
VTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGVITYILLCGFEPFFDERGDQYMFKKIL
NCEYEFVSPWWDDVSLNAKDLVKKLIVQDPKKRLSTVQALQHPWVTGKAVNSAHMDTAQK
KLQEFNARRKLKAAVKAVVASSRLGSAGSHNSTDNSKISCNHSPVQEGAPERQAQQTHPP
KQGDS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagtcaccatgccctcctccagttcaggggcggcttcagaatactggatagat
ggctcaaaaaaggagacgcttgcagattactacgagctgcagtccgaattgggacgggga
gccacgtcggttgtctttcgatgtagacagaagggaactcagaagccctatgctgtaaaa
atgttgaagaaaacggtcgataagaagatcgtgaggacggaaatcggtgttttgcttcgg
ctctcacatccaaacattattaaattgaaagagatattcgagaccccggccgagatcagt
ctggttctggagctggtcactgggggagagctgtttgacaggatcgtcgagaaggggtat
tacagtgagcgggacgccgccgatgctgtcaaacagatcctggaggctgtcgcgtacctg
catgagaacggagtggtgcaccgggacttgaagccagagaacctcctatatgctacttca
gctccagatgctcctctcaaaatcgctgattttggtctttcaaaaatcgtggatgaccag
gtcactatgaagacagtatgtgggactccaggatattgcgctcctgaaatccttcggggt
tgcgcctacggacctgaggtggacatgtggtcagtgggagtcattacgtacatcttattg
tgcggcttcgaaccgttctttgacgaacggggtgaccagtacatgttcaagaagattctt
aactgcgaatatgagtttgtctccccctggtgggatgacgtgtctctaaatgccaaggac
ctggtgaagaagctgatcgtccaggatccaaagaagcggctaagcacggtgcaggccctg
cagcacccctgggtgacaggcaaggccgtcaactccgcccacatggacacagcgcagaag
aaactgcaggagttcaacgctcgccgcaagctcaaggcagccgtgaaggctgtggtggcc
tcttcacggctaggcagcgccggcagccacaacagcaccgacaacagtaagatcagctgt
aaccactctccagtccaggagggggcgccagaaagacaggctcagcaaacccacccgccg
aaacagggggactcctag

DBGET integrated database retrieval system