KEGG   Paramormyrops kingsleyae: 111836940Help
Entry
111836940         CDS       T05788                                 

Gene name
amdhd2
Definition
(RefSeq) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00520  Amino sugar and nucleotide sugar metabolism
pki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    111836940 (amdhd2)
Enzymes [BR:pki01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     111836940 (amdhd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 111836940
NCBI-ProteinID: XP_023654413
Ensembl: ENSPKIG00000022364
Position
Unknown
AA seq 403 aa AA seqDB search
MPSNKSVSEEPITQFVNCRILKDHQLQREDLWVREGKILNPEKLFFDEEGYADHQVDCES
KILAPGFIDVQINGGYGVDFSQGCDVRGGVALVSKRLLEHGVTSFCPTLVTSPPHIYHKV
LPEMEVHDGGAEGAGVLGVHLEGPFISREKRGAHPEHCLRSFQQGSLTDLLEVYGSLDNV
SIVTLAPELPGSPTVIQELVKMGVTVSLGHSVADLSQAEQAVQQGATFITHLFNAMLPFH
HRDPGIVGLLTSDQLPPNCTVFYGMIADGIHTNPAALRIAHRAHPSGLVLVTDAITAMGL
PPGHHTLGQQHIQIDGLHAYVAGTNTLCGSIATMDMCVRHFRKASGCSVEAALEAASLHP
AQLLGISQHKGTLDYGSDADFVLLDDSLHVKATYIGGEEVWRK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctaacaagtctgtgtctgaagagccgatcacacagttcgttaactgcagaatc
ctgaaggaccaccagctacagagggaggacctgtgggttcgagaagggaaaatcctaaat
ccagaaaagctgttctttgatgaggaaggctatgcagatcaccaggtggactgtgagagc
aaaatacttgctccaggtttcattgatgttcagatcaatggtgggtatggagttgatttc
tcacaaggatgtgatgttcgtggcggtgtggccttggtgtccaagcggctcttggagcat
ggtgtgacttccttctgccccacactggtgacctccccacctcacatctaccacaaggtc
ctcccagagatggaagttcatgatggaggagctgaaggagcaggggttttgggagttcac
ctggaaggcccgttcatcagcagagagaagcggggagcccatccggagcactgcttacgc
agctttcagcaggggagtctgacagacttactagaggtctacggcagcctggacaatgtg
tccattgtcacgctggcaccagagcttccgggcagcccgactgtaatccaagaattggtg
aagatgggggtgactgtgtctcttgggcattcagtggcagatctgtcccaggcagaacag
gctgtccagcagggggcaaccttcatcacacacctcttcaatgccatgcttccgttccat
catcgggatcctggcattgtggggctgttgacaagtgatcaacttccaccaaattgcaca
gttttttacgggatgattgcggatggcattcacacgaatcctgccgcccttcgaatagcc
catcgtgctcacccttcaggcttggtgctggtgacagatgccatcacagccatggggttg
cccccaggacatcacaccctcggccagcagcacatccagatcgacgggctgcatgcttat
gtggcaggcaccaacaccctgtgtgggagcatcgccaccatggatatgtgtgtcagacac
ttccgaaaggcctctggatgctcagtggaagctgcactggaggctgcctctctgcatcca
gcccagctgctggggatcagtcaacataaagggaccctggactatggctcagatgcagac
tttgtcctactggacgattccttgcatgtgaaagctacctacataggtggagaagaggtt
tggcggaagtga

DBGET integrated database retrieval system